Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTLA4W2)

DOT Name Ankyrin repeat domain-containing protein 50 (ANKRD50)
Gene Name ANKRD50
Related Disease
Parkinson disease ( )
Lupus nephritis ( )
Schizophrenia ( )
UniProt ID
ANR50_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796 ; PF13637
Sequence
MTNPWEEKVCKMAQTSLLQGKQFYCREWVFHKLQHCLQEKSNCCNSAVNAPSLVMNSGNN
ASGVSGKGAAWGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDT
LCVGGFIRGLVAQICRSGLLQGYEDKLRDPAVQSLLQPGECERNPAEAFKRCVLLPLLGM
KPPQQSLYLLVDSVDEGCNITEGEQTSTSLSGTVAALLAGHHEFFPPWLLLLCSARKQSK
AVTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEALRQHLTKETAEMLNQLHIKSS
GCFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKVQPILNVILAA
CRPLTITELYHAVWTKNMSLTLEDFQRKLDILSKLLVDGLGNTKILFHYSFAEWLLDVKH
CTQKYLCNAAEGHRMLAMSYTCQAKNLTPLEAQEFALHLINSNLQLETAELALWMIWNGT
PVRDSLSTLIPKEQEVLQLLVKAGAHVNSEDDRTSCIVRQALEREDSIRTLLDNGASVNQ
CDSNGRTLLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGC
GANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIV
LNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALC
VPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNN
GRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDE
NHRDDAGWTPLHMAAFEGHRLICEALIEQGARTNEIDNDGRIPFILASQEGHYDCVQILL
ENKSNIDQRGYDGRNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLT
MAEYFLENGANVEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAA
WQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHADQFGRT
AMRVAAKNGHSQIIKLLEKYGASSLNGCSPSPVHTMEQKPLQSLSSKVQSLTIKSNSSGS
TGGGDMQPSLRGLPNGPTHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTTSSTAT
AQTVPIDSFHNLSFTEQIQQHSLPRSRSRQSIVSPSSTTQSLGQSHNSPSSEFEWSQVKP
SLKSTKASKGGKSENSAKSGSAGKKAKQSNSSQPKVLEYEMTQFDRRGPIAKSGTAAPPK
QMPAESQCKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVS
VPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFNYKKETPL
Function Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Parkinson disease DISQVHKL Definitive Genetic Variation [1]
Lupus nephritis DISCVGPZ moderate Genetic Variation [2]
Schizophrenia DISSRV2N No Known Unknown [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [5]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [8]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [9]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [10]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [11]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [13]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [14]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [18]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [19]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Ankyrin repeat domain-containing protein 50 (ANKRD50). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Ankyrin repeat domain-containing protein 50 (ANKRD50). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Ankyrin repeat domain-containing protein 50 (ANKRD50). [16]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Ankyrin repeat domain-containing protein 50 (ANKRD50). [17]
------------------------------------------------------------------------------------

References

1 Retromer- and WASH-dependent sorting of nutrient transporters requires a multivalent interaction network with ANKRD50.J Cell Sci. 2017 Jan 15;130(2):382-395. doi: 10.1242/jcs.196758. Epub 2016 Dec 1.
2 Detecting Genetic Associations between ATG5 and Lupus Nephritis by trans-eQTL.J Immunol Res. 2015;2015:153132. doi: 10.1155/2015/153132. Epub 2015 Oct 5.
3 Whole Exome Sequencing of Patients from Multicase Families with Systemic Lupus Erythematosus Identifies Multiple Rare Variants. Sci Rep. 2018 Jun 8;8(1):8775. doi: 10.1038/s41598-018-26274-y.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
18 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
19 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
20 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.