Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTTYMAQ)

DOT Name Syntaxin-binding protein 3 (STXBP3)
Synonyms Platelet Sec1 protein; PSP; Protein unc-18 homolog 3; Unc18-3; Protein unc-18 homolog C; Unc-18C
Gene Name STXBP3
Related Disease
Attention deficit hyperactivity disorder ( )
Neoplasm ( )
Schizophrenia ( )
Wolfram syndrome ( )
Advanced cancer ( )
Autonomic nervous system disorder ( )
Bipolar disorder ( )
Corticobasal degeneration ( )
Dementia ( )
Depression ( )
Dysautonomia ( )
Familial spontaneous pneumothorax ( )
Frontotemporal dementia ( )
Late-onset Parkinson disease ( )
Matthew-Wood syndrome ( )
Myotonic dystrophy ( )
Obesity ( )
Pancreatitis ( )
Parkinson disease ( )
Pick disease ( )
Pneumothorax ( )
Postencephalitic Parkinson disease ( )
Primary progressive aphasia ( )
Progressive supranuclear palsy ( )
Prostate adenocarcinoma ( )
Sjogren syndrome ( )
Tauopathy ( )
Type-1/2 diabetes ( )
Anxiety ( )
Anxiety disorder ( )
Lewy body dementia ( )
Nervous system disease ( )
Non-insulin dependent diabetes ( )
Nutritional disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
STXB3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00995
Sequence
MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGIT
VVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFN
KIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQ
IVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAILEEEDDLWVRIRHRHIAVV
LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNLAEDCMNKFKL
NIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTE
ENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGIT
YSEVRCAYEVSQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE
Function Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes.
Tissue Specificity Megakaryocytes and platelets.
Reactome Pathway
Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )
Disinhibition of SNARE formation (R-HSA-114516 )

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Attention deficit hyperactivity disorder DISL8MX9 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Altered Expression [2]
Schizophrenia DISSRV2N Definitive Altered Expression [1]
Wolfram syndrome DISN16XW Definitive Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Autonomic nervous system disorder DIS6JLTA Strong Biomarker [5]
Bipolar disorder DISAM7J2 Strong Biomarker [6]
Corticobasal degeneration DISSMOTT Strong Biomarker [7]
Dementia DISXL1WY Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [6]
Dysautonomia DISF4MT6 Strong Biomarker [5]
Familial spontaneous pneumothorax DISNM7SU Strong Biomarker [9]
Frontotemporal dementia DISKYHXL Strong Biomarker [10]
Late-onset Parkinson disease DIS9IOUI Strong Biomarker [11]
Matthew-Wood syndrome DISA7HR7 Strong Genetic Variation [2]
Myotonic dystrophy DISNBEMX Strong Biomarker [5]
Obesity DIS47Y1K Strong Altered Expression [12]
Pancreatitis DIS0IJEF Strong Biomarker [13]
Parkinson disease DISQVHKL Strong Genetic Variation [14]
Pick disease DISP6X50 Strong Genetic Variation [15]
Pneumothorax DISP86H1 Strong Genetic Variation [16]
Postencephalitic Parkinson disease DIS1TYXP Strong Biomarker [8]
Primary progressive aphasia DISLRYFE Strong Biomarker [17]
Progressive supranuclear palsy DISO5KRQ Strong Biomarker [18]
Prostate adenocarcinoma DISBZYU8 Strong Genetic Variation [19]
Sjogren syndrome DISUBX7H Strong Biomarker [20]
Tauopathy DISY2IPA Strong Genetic Variation [15]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [3]
Anxiety DISIJDBA Disputed Biomarker [21]
Anxiety disorder DISBI2BT Disputed Biomarker [21]
Lewy body dementia DISAE66J Limited Biomarker [22]
Nervous system disease DISJ7GGT Limited Biomarker [18]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [23]
Nutritional disorder DIS0W6QK Limited Biomarker [24]
Prostate cancer DISF190Y Limited Biomarker [25]
Prostate carcinoma DISMJPLE Limited Biomarker [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Regulation of Drug Effects of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Serotonin DMOFCRY Investigative Syntaxin-binding protein 3 (STXBP3) affects the secretion of Serotonin. [33]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Syntaxin-binding protein 3 (STXBP3). [26]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Syntaxin-binding protein 3 (STXBP3). [27]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Syntaxin-binding protein 3 (STXBP3). [28]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Syntaxin-binding protein 3 (STXBP3). [29]
Nicotine DMWX5CO Approved Nicotine increases the expression of Syntaxin-binding protein 3 (STXBP3). [30]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Syntaxin-binding protein 3 (STXBP3). [31]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Syntaxin-binding protein 3 (STXBP3). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Cognitive and behavioral precursors of schizophrenia.Dev Psychopathol. 1999 Summer;11(3):487-508. doi: 10.1017/s0954579499002175.
2 Human pancreatic cancer contains a side population expressing cancer stem cell-associated and prognostic genes.PLoS One. 2013 Sep 17;8(9):e73968. doi: 10.1371/journal.pone.0073968. eCollection 2013.
3 Pancreatic stone protein/regenerating protein is a potential biomarker for endoplasmic reticulum stress in beta cells.Sci Rep. 2019 Mar 26;9(1):5199. doi: 10.1038/s41598-019-41604-4.
4 Analyzing the capability of PSP, PCT and sCD25 to support the diagnosis of infection in cancer patients with febrile neutropenia.Clin Chem Lab Med. 2019 Mar 26;57(4):540-548. doi: 10.1515/cclm-2018-0154.
5 Coexistence of Progressive Supranuclear Palsy With Pontocerebellar Atrophy and Myotonic Dystrophy Type 1.J Neuropathol Exp Neurol. 2019 Aug 1;78(8):756-762. doi: 10.1093/jnen/nlz048.
6 Self-Reported Graphic Personal and Social Performance Scale (SRG-PSP) for measuring functionality in patients with bipolar disorder.J Affect Disord. 2017 Jun;215:256-262. doi: 10.1016/j.jad.2017.02.018. Epub 2017 Feb 20.
7 Side effects induced by the acute levodopa challenge in Parkinson's Disease and atypical parkinsonisms.PLoS One. 2017 Feb 16;12(2):e0172145. doi: 10.1371/journal.pone.0172145. eCollection 2017.
8 Parkinson's syndrome associated with neurofibrillary degeneration and tau pathologic findings.Mov Disord. 2003 Sep;18 Suppl 6:S28-33. doi: 10.1002/mds.10560.
9 A novel dual-covering method in video-assisted thoracic surgery for pediatric primary spontaneous pneumothorax.Surg Today. 2019 Jul;49(7):587-592. doi: 10.1007/s00595-019-01785-x. Epub 2019 Apr 6.
10 Cerebellar atrophy in neurodegeneration-a meta-analysis.J Neurol Neurosurg Psychiatry. 2017 Sep;88(9):780-788. doi: 10.1136/jnnp-2017-315607. Epub 2017 May 13.
11 Manual MRI morphometry in Parkinsonian syndromes.Mov Disord. 2017 May;32(5):778-782. doi: 10.1002/mds.26921. Epub 2017 Feb 2.
12 Munc18c in adipose tissue is downregulated in obesity and is associated with insulin.PLoS One. 2013 May 20;8(5):e63937. doi: 10.1371/journal.pone.0063937. Print 2013.
13 Depletion of the membrane-fusion regulator Munc18c attenuates caerulein hyperstimulation-induced pancreatitis.J Biol Chem. 2018 Feb 16;293(7):2510-2522. doi: 10.1074/jbc.RA117.000792. Epub 2017 Dec 28.
14 The genetic and clinico-pathological profile of early-onset progressive supranuclear palsy.Mov Disord. 2019 Sep;34(9):1307-1314. doi: 10.1002/mds.27786. Epub 2019 Jul 12.
15 Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
16 Primary and Secondary Spontaneous Pneumothorax: Prevalence, Clinical Features, and In-Hospital Mortality.Can Respir J. 2017;2017:6014967. doi: 10.1155/2017/6014967. Epub 2017 Mar 13.
17 C9ORF72 repeat expansions in the frontotemporal dementias spectrum of diseases: a flow-chart for genetic testing.J Alzheimers Dis. 2013;34(2):485-99. doi: 10.3233/JAD-121456.
18 Sensitivity and Specificity of Diagnostic Criteria for Progressive Supranuclear Palsy.Mov Disord. 2019 Aug;34(8):1144-1153. doi: 10.1002/mds.27619. Epub 2019 Feb 6.
19 A novel knock-in prostate cancer model demonstrates biology similar to that of human prostate cancer and suitable for preclinical studies.Mol Ther. 2005 Mar;11(3):348-62. doi: 10.1016/j.ymthe.2004.12.005.
20 Novel Sjgren's autoantibodies found in fibromyalgia patients with sicca and/or xerostomia.Autoimmun Rev. 2019 Feb;18(2):199-202. doi: 10.1016/j.autrev.2018.09.004. Epub 2018 Dec 18.
21 Psychological factors predict an unfavorable pain trajectory after hysterectomy: a prospective cohort study on chronic postsurgical pain.Pain. 2018 May;159(5):956-967. doi: 10.1097/j.pain.0000000000001170.
22 Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
23 The SNARE protein SNAP23 and the SNARE-interacting protein Munc18c in human skeletal muscle are implicated in insulin resistance/type 2 diabetes.Diabetes. 2010 Aug;59(8):1870-8. doi: 10.2337/db09-1503. Epub 2010 May 11.
24 Radiolucent and calcified pancreatic lithiasis: two different diseases. Role of alcohol and heredity.Scand J Gastroenterol. 1992;27(1):71-6. doi: 10.3109/00365529209011170.
25 Comparison of prostate-specific promoters and the use of PSP-driven virotherapy for prostate cancer.Biomed Res Int. 2013;2013:624632. doi: 10.1155/2013/624632. Epub 2013 Jan 31.
26 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
27 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
28 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
29 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
30 Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
31 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
32 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
33 Luminal regulation of normal and neoplastic human EC cell serotonin release is mediated by bile salts, amines, tastants, and olfactants. Am J Physiol Gastrointest Liver Physiol. 2008 Aug;295(2):G260-72. doi: 10.1152/ajpgi.00056.2008. Epub 2008 Jun 12.