Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU2TXCA)

• DOT Name: Atos homolog protein B (ATOSB)
• Gene Name: ATOSB
• UniProt ID: ATOSB_HUMAN
• Pfam ID: PF13889 ; PF13915
• Sequence:
  MRHVQAEPSPSSEPEAGPSQPPVRQGALQGGLLMGYSPAGGATSPGVYQVSIFSPPAGTS
  EPHRALKRQAPSTEGPRELKRGPGLGAREGLPPEEPSTVGLLGPEGPGLGLGVASQHFSH
  RGLCVVEQRSSVTSSWTSGAWSPPCPPSNASCNTLHTRDWASPDPGGQGSLGESPGPAPP
  GQLHTLDTDLHSLAQIGGKSPVAGVGNGGSLWPRESPGTANGHSPEHTPPGPGPPGPCPT
  KRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDP
  TDCGPMGRRLKGARRLKLSPLRSLRKGPGLLSPPSASPVPTPAVSRTLLGNFEESLLRGR
  FAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQNAPAPFLGIVDLNPLGRKGYS
  VPKVGTVQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEEGNANPTHRL
  LCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTGLPYELQAVTEAPHNPRYSPLP
• Function: Transcription regulator that may syncronize transcriptional and translational programs.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Atos homolog protein B (ATOSB).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Atos homolog protein B (ATOSB).	[10]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Atos homolog protein B (ATOSB).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Atos homolog protein B (ATOSB).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Atos homolog protein B (ATOSB).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Atos homolog protein B (ATOSB).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Atos homolog protein B (ATOSB).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Atos homolog protein B (ATOSB).	[6]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Atos homolog protein B (ATOSB).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Atos homolog protein B (ATOSB).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Atos homolog protein B (ATOSB).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Atos homolog protein B (ATOSB).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Atos homolog protein B (ATOSB).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Atos homolog protein B (ATOSB).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [7] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.