Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVOMCW4)

• DOT Name: Transcription factor HIVEP2 (HIVEP2)
• Synonyms: Human immunodeficiency virus type I enhancer-binding protein 2; HIV-EP2; MHC-binding protein 2; MBP-2
• Gene Name: HIVEP2
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Glioma
  Hepatitis B virus infection
  Intellectual disability, autosomal dominant 43
  Myocardial ischemia
  Non-insulin dependent diabetes
  Schizophrenia
  Coronary heart disease
  Autosomal dominant non-syndromic intellectual disability
  Intellectual disability
• UniProt ID: ZEP2_HUMAN
• Pfam ID: PF00096
• Sequence:
  MDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSHEGQRQPQIEPEQIGNTAS
  AQLFGSGKLASPSEVVQQVAEKQYPPHRPSPYSCQHSLSFPQHSLPQGVMHSTKPHQSLE
  GPPWLFPGPLPSVASEDLFPFPIHGHSGGYPRKKISSLNPAYSQYSQKSIEQAEEAHKKE
  HKPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHA
  HAIKAGLVPFTESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFAEASDKMSPGPP
  IPLDIASRGGYHGSLEESLGGPMKVPILIIPKSGIPLPNESSQYIGPDMLPNPSLNTKAD
  DSHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAKS
  YEEIIFGKYCRLSPRNALSVTTTSQERAAMGRKGIMEPLPHVNTRLDVKMFEDPVSQLIP
  SKGDVDPSQTSMLKSTKFNSESRQPQIIPSSIRNEGKLYPANFQGSNPVLLEAPVDSSPL
  IRSNSVPTSSATNLTIPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPS
  VQEGHVEVEHHGRMLKGISSSSLKEKKLSPGDRVGYDYDVCRKPYKKWEDSETPKQNYRD
  ISCLSSLKHGGEYFMDPVVPLQGVPSMFGTTCENRKRRKEKSVGDEEDTPMICSSIVSTP
  VGIMASDYDPKLQMQEGVRSGFAMAGHENLSHGHTERFDPCRPQLQPGSPSLVSEESPSA
  IDSDKMSDLGGRKPPGNVISVIQHTNSLSRPNSFERSESAELVACTQDKAPSPSETCDSE
  ISEAPVSPEWAPPGDGAESGGKPSPSQQVQQQSYHTQPRLVRQHNIQVPEIRVTEEPDKP
  EKEKEAQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFESTG
  TGLSRSPSQESNLSHSSSFSMSFEREETSKLSALPKQDEFGKHSEFLTVPAGSYSLSVPG
  HHHQKEMRRCSSEQMPCPHPAEVPEVRSKSFDYGNLSHAPVSGAAASTVSPSRERKKCFL
  VRQASFSGSPEISQGEVGMDQSVKQEQLEHLHAGLRSGWHHGPPAVLPPLQQEDPGKQVA
  GPCPPLSSGPLHLAQPQIMHMDSQESLRNPLIQPTSYMTSKHLPEQPHLFPHQETIPFSP
  IQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYPLEHV
  AEHTGKKPAEYAHTKEQTYPCYSGASGLHPKNLLPKFPSDQSSKSTETPSEQVLQEDFAS
  ANAGSLQSLPGTVVPVRIQTHVPSYGSVMYTSISQILGQNSPAIVICKVDENMTQRTLVT
  NAAMQGIGFNIAQVLGQHAGLEKYPIWKAPQTLPLGLESSIPLCLPSTSDSVATLGGSKR
  MLSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQGC
  ASEPKDGLQSGSSSFSSLSPSSSQDYPSVSPSSREPFLPSKEMLSGSRAPLPGQKSSGPS
  ESKESSDELDIDETASDMSMSPQSSSLPAGDGQLEEEGKGHKRPVGMLVRMASAPSGNVA
  DSTLLLTDMADFQQILQFPSLRTTTTVSWCFLNYTKPNYVQQATFKSSVYASWCISSCNP
  NPSGLNTKTTLALLRSKQKITAEIYTLAAMHRPGTGKLTSSSAWKQFTQMKPDASFLFGS
  KLERKLVGNILKERGKGDIHGDKDIGSKQTEPIRIKIFEGGYKSNEDYVYVRGRGRGKYI
  CEECGIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKAHMKKCLELGV
  SMTSVDDTETEEAENLEDLHKAAEKHSMSSISTDHQFSDAEESDGEDGDDNDDDDEDEDD
  FDDQGDLTPKTRSRSTSPQPPRFSSLPVNVGAVPHGVPSDSSLGHSSLISYLVTLPSIRV
  TQLMTPSDSCEDTQMTEYQRLFQSKSTDSEPDKDRLDIPSCMDEECMLPSEPSSSPRDFS
  PSSHHSSPGYDSSPCRDNSPKRYLIPKGDLSPRRHLSPRRDLSPMRHLSPRKEAALRREM
  SQRDVSPRRHLSPRRPVSPGKDITARRDLSPRRERRYMTTIRAPSPRRALYHNPPLSMGQ
  YLQAEPIVLGPPNLRRGLPQVPYFSLYGDQEGAYEHPGSSLFPEGPNDYVFSHLPLHSQQ
  QVRAPIPMVPVGGIQMVHSMPPALSSLHPSPTLPLPMEGFEEKKGASGESFSKDPYVLSK
  QHEKRGPHALQSSGPPSTPSSPRLLMKQSTSEDSLNATEREQEENIQTCTKAIASLRIAT
  EEAALLGPDQPARVQEPHQNPLGSAHVSIRHFSRPEPGQPCTSATHPDLHDGEKDNFGTS
  QTPLAHSTFYSKSCVDDKQLDFHSSKELSSSTEESKDPSSEKSQLH
• Function: This protein specifically binds to the DNA sequence 5'-GGGACTTTCC-3' which is found in the enhancer elements of numerous viral promoters such as those of SV40, CMV, or HIV1. In addition, related sequences are found in the enhancer elements of a number of cellular promoters, including those of the class I MHC, interleukin-2 receptor, somatostatin receptor II, and interferon-beta genes. It may act in T-cell activation.
• Tissue Specificity: Expressed in brain and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[3]
Glioma	DIS5RPEH	Strong	Biomarker	[1]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[4]
Intellectual disability, autosomal dominant 43	DISBIFAB	Strong	Autosomal dominant	[5]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[6]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[3]
Schizophrenia	DISSRV2N	Strong	Biomarker	[7]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[8]
Autosomal dominant non-syndromic intellectual disability	DISD6L06	Supportive	Autosomal dominant	[9]
Intellectual disability	DISMBNXP	Limited	Biomarker	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcription factor HIVEP2 (HIVEP2).	[11]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Transcription factor HIVEP2 (HIVEP2).	[31]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transcription factor HIVEP2 (HIVEP2).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor HIVEP2 (HIVEP2).	[13]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transcription factor HIVEP2 (HIVEP2).	[14]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[15]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor HIVEP2 (HIVEP2).	[16]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transcription factor HIVEP2 (HIVEP2).	[17]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Transcription factor HIVEP2 (HIVEP2).	[18]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transcription factor HIVEP2 (HIVEP2).	[19]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Transcription factor HIVEP2 (HIVEP2).	[20]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[21]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Transcription factor HIVEP2 (HIVEP2).	[22]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[23]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Transcription factor HIVEP2 (HIVEP2).	[24]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Transcription factor HIVEP2 (HIVEP2).	[25]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[26]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor HIVEP2 (HIVEP2).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[21]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Transcription factor HIVEP2 (HIVEP2).	[28]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Transcription factor HIVEP2 (HIVEP2).	[29]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Transcription factor HIVEP2 (HIVEP2).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcription factor HIVEP2 (HIVEP2).	[19]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[32]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Transcription factor HIVEP2 (HIVEP2).	[33]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Transcription factor HIVEP2 (HIVEP2).	[34]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Transcription factor HIVEP2 (HIVEP2).	[19]

References

• [1] Identification and characterization of human MIBP1 gene in glioma cell differentiation.J Mol Neurosci. 2014 Feb;52(2):294-301. doi: 10.1007/s12031-013-0144-z. Epub 2013 Oct 26.
• [2] Frequent down-regulation of HIVEP2 in human breast cancer.Breast Cancer Res Treat. 2005 May;91(2):103-12. doi: 10.1007/s10549-004-5779-6.
• [3] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [4] Interactions of the transcription factors MIBP1 and RFX1 with the EP element of the hepatitis B virus enhancer.J Virol. 1996 Sep;70(9):6060-6. doi: 10.1128/JVI.70.9.6060-6066.1996.
• [5] Range of genetic mutations associated with severe non-syndromic sporadic intellectual disability: an exome sequencing study. Lancet. 2012 Nov 10;380(9854):1674-82. doi: 10.1016/S0140-6736(12)61480-9. Epub 2012 Sep 27.
• [6] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [7] Attenuated bidirectional short-term synaptic plasticity in the dentate gyrus of Schnurri-2 knockout mice, a model of schizophrenia.Mol Brain. 2018 Oct 1;11(1):56. doi: 10.1186/s13041-018-0400-9.
• [8] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [9] Loss-of-function variants in HIVEP2 are a cause of intellectual disability. Eur J Hum Genet. 2016 Apr;24(4):556-61. doi: 10.1038/ejhg.2015.151. Epub 2015 Jul 8.
• [10] Expanding the phenotype of intellectual disability caused by HIVEP2 variants.Am J Med Genet A. 2019 Sep;179(9):1872-1877. doi: 10.1002/ajmg.a.61271. Epub 2019 Jun 17.
• [11] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [12] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [13] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [14] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [15] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [16] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [17] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [18] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [19] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [20] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [21] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [22] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [23] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [24] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [25] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [26] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [27] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [28] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [29] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [30] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [33] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [34] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.