Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY850JC)

• DOT Name: Kinesin-like protein KIF23 (KIF23)
• Synonyms: Kinesin-like protein 5; Mitotic kinesin-like protein 1
• Gene Name: KIF23
• Related Disease:
  Glioma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Estrogen-receptor positive breast cancer
  Gastric cancer
  Hepatocellular carcinoma
  Herpes simplex infection
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Malignant glioma
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Stomach cancer
  Melanoma
  Congenital dyserythropoietic anemia type 3
  Lung adenocarcinoma
  Malignant pleural mesothelioma
• UniProt ID: KIF23_HUMAN
• PDB ID: 3VHX
• Pfam ID: PF00225 ; PF16540
• Sequence:
  MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGY
  RLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTH
  TMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMP
  NPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
  PIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
  SHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNI
  NQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY
  EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPL
  PSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHM
  QGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKL
  QRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTE
  PKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSI
  SVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTF
  RNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH
  AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQ
  ESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
• Function: Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Essential for cytokinesis in Rho-mediated signaling. Required for the localization of ECT2 to the central spindle. Plus-end-directed motor enzyme that moves antiparallel microtubules in vitro.
• Tissue Specificity: Widely expressed.
• KEGG Pathway:
  Motor proteins (hsa04814)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  Mitotic Telophase/Cytokinesis (R-HSA-68884)
  Kinesins (R-HSA-983189)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[2]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[5]
Gastric cancer	DISXGOUK	Strong	Biomarker	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	Strong	Biomarker	[9]
Lung carcinoma	DISTR26C	Strong	Biomarker	[9]
Lung neoplasm	DISVARNB	Strong	Biomarker	[9]
Malignant glioma	DISFXKOV	Strong	Altered Expression	[10]
Neoplasm	DISZKGEW	Strong	Altered Expression	[11]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[2]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[2]
Stomach cancer	DISKIJSX	Strong	Biomarker	[6]
Melanoma	DIS1RRCY	moderate	Biomarker	[12]
Congenital dyserythropoietic anemia type 3	DISPCPCH	Supportive	Autosomal dominant	[13]
Lung adenocarcinoma	DISD51WR	Limited	Biomarker	[9]
Malignant pleural mesothelioma	DIST2R60	Limited	Biomarker	[14]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Kinesin-like protein KIF23 (KIF23) affects the response to substance of Mitomycin.	[53]
Vinblastine	DM5TVS3	Approved	Kinesin-like protein KIF23 (KIF23) affects the response to substance of Vinblastine.	[53]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Kinesin-like protein KIF23 (KIF23).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Kinesin-like protein KIF23 (KIF23).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Kinesin-like protein KIF23 (KIF23).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Kinesin-like protein KIF23 (KIF23).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Kinesin-like protein KIF23 (KIF23).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Kinesin-like protein KIF23 (KIF23).	[20]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Kinesin-like protein KIF23 (KIF23).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Kinesin-like protein KIF23 (KIF23).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Kinesin-like protein KIF23 (KIF23).	[24]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Kinesin-like protein KIF23 (KIF23).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Kinesin-like protein KIF23 (KIF23).	[26]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Kinesin-like protein KIF23 (KIF23).	[26]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Kinesin-like protein KIF23 (KIF23).	[27]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Kinesin-like protein KIF23 (KIF23).	[28]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Kinesin-like protein KIF23 (KIF23).	[29]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Kinesin-like protein KIF23 (KIF23).	[30]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Kinesin-like protein KIF23 (KIF23).	[31]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Kinesin-like protein KIF23 (KIF23).	[32]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Kinesin-like protein KIF23 (KIF23).	[33]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Kinesin-like protein KIF23 (KIF23).	[34]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Kinesin-like protein KIF23 (KIF23).	[35]
Riboflavin	DM8YMWE	Approved	Riboflavin affects the expression of Kinesin-like protein KIF23 (KIF23).	[36]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Kinesin-like protein KIF23 (KIF23).	[37]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Kinesin-like protein KIF23 (KIF23).	[21]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Kinesin-like protein KIF23 (KIF23).	[38]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Kinesin-like protein KIF23 (KIF23).	[39]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Kinesin-like protein KIF23 (KIF23).	[40]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Kinesin-like protein KIF23 (KIF23).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Kinesin-like protein KIF23 (KIF23).	[42]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Kinesin-like protein KIF23 (KIF23).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Kinesin-like protein KIF23 (KIF23).	[45]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Kinesin-like protein KIF23 (KIF23).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Kinesin-like protein KIF23 (KIF23).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Kinesin-like protein KIF23 (KIF23).	[48]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Kinesin-like protein KIF23 (KIF23).	[49]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of Kinesin-like protein KIF23 (KIF23).	[50]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Kinesin-like protein KIF23 (KIF23).	[51]
Choline	DM5D9YK	Investigative	Choline affects the expression of Kinesin-like protein KIF23 (KIF23).	[52]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Kinesin-like protein KIF23 (KIF23).	[23]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Kinesin-like protein KIF23 (KIF23).	[44]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Kinesin-like protein KIF23 (KIF23).	[46]

References

• [1] MicroRNA-424 inhibits cell migration, invasion and epithelial-mesenchymal transition in human glioma by targeting KIF23 and functions as a novel prognostic predictor.Eur Rev Med Pharmacol Sci. 2018 Oct;22(19):6369-6378. doi: 10.26355/eurrev_201810_16049.
• [2] Methylation-mediated repression of MiR-424/503 cluster promotes proliferation and migration of ovarian cancer cells through targeting the hub gene KIF23.Cell Cycle. 2019 Jul;18(14):1601-1618. doi: 10.1080/15384101.2019.1624112. Epub 2019 Jun 9.
• [3] Distinct Diagnostic and Prognostic Values of Kinesin Family Member Genes Expression in Patients with Breast Cancer.Med Sci Monit. 2018 Dec 29;24:9442-9464. doi: 10.12659/MSM.913401.
• [4] Identification of novel variants in colorectal cancer families by high-throughput exome sequencing.Cancer Epidemiol Biomarkers Prev. 2013 Jul;22(7):1239-51. doi: 10.1158/1055-9965.EPI-12-1226. Epub 2013 May 1.
• [5] Kinesin family deregulation coordinated by bromodomain protein ANCCA and histone methyltransferase MLL for breast cancer cell growth, survival, and tamoxifen resistance.Mol Cancer Res. 2014 Apr;12(4):539-49. doi: 10.1158/1541-7786.MCR-13-0459. Epub 2014 Jan 3.
• [6] KIF23 Promotes Gastric Cancer by Stimulating Cell Proliferation.Dis Markers. 2019 Mar 17;2019:9751923. doi: 10.1155/2019/9751923. eCollection 2019.
• [7] Integrated analysis of competing endogenous RNA network revealing potential prognostic biomarkers of hepatocellular carcinoma.J Cancer. 2019 Jun 2;10(14):3267-3283. doi: 10.7150/jca.29986. eCollection 2019.
• [8] Downregulation of KIF23 suppresses glioma proliferation.J Neurooncol. 2012 Feb;106(3):519-29. doi: 10.1007/s11060-011-0706-2. Epub 2011 Sep 9.
• [9] An important role for Myb-MuvB and its target gene KIF23 in a mouse model of lung adenocarcinoma.Oncogene. 2017 Jan 5;36(1):110-121. doi: 10.1038/onc.2016.181. Epub 2016 May 23.
• [10] KIF23 is an independent prognostic biomarker in glioma, transcriptionally regulated by TCF-4.Oncotarget. 2016 Apr 26;7(17):24646-55. doi: 10.18632/oncotarget.8261.
• [11] Overexpression of KIF23 predicts clinical outcome in primary lung cancer patients.Lung Cancer. 2016 Feb;92:53-61. doi: 10.1016/j.lungcan.2015.11.018. Epub 2015 Nov 27.
• [12] Comprehensive genomic characterization of cutaneous malignant melanoma cell lines derived from metastatic lesions by whole-exome sequencing and SNP array profiling.PLoS One. 2013 May 21;8(5):e63597. doi: 10.1371/journal.pone.0063597. Print 2013.
• [13] Congenital dyserythropoietic anemia type III (CDA III) is caused by a mutation in kinesin family member, KIF23. Blood. 2013 Jun 6;121(23):4791-9. doi: 10.1182/blood-2012-10-461392. Epub 2013 Apr 9.
• [14] Kinesin family members KIF11 and KIF23 as potential therapeutic targets in malignant pleural mesothelioma.Int J Oncol. 2016 Aug;49(2):448-56. doi: 10.3892/ijo.2016.3566. Epub 2016 Jun 7.
• [15] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [16] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [17] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [18] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [19] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [26] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [27] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [28] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [29] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [30] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [31] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [32] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [33] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [34] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [35] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [36] Riboflavin depletion impairs cell proliferation in adult human duodenum: identification of potential effectors. Dig Dis Sci. 2011 Apr;56(4):1007-19. doi: 10.1007/s10620-010-1374-3. Epub 2010 Sep 17.
• [37] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [38] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [39] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [40] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [41] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [42] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [43] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [44] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [47] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [48] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [49] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [50] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [51] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [52] Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.
• [53] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.