Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ4IFGJ)

DOT Name	Protein OSCP1 (OSCP1)
Synonyms	hOSCP1; Organic solute transport protein 1; Oxidored-nitro domain-containing protein 1
Gene Name	OSCP1
Related Disease	Chondrosarcoma ( ) Holoprosencephaly ( ) Abdominal aortic aneurysm ( ) Acute monocytic leukemia ( ) Advanced cancer ( ) Arteriosclerosis ( ) Atherosclerosis ( ) B-cell neoplasm ( ) Breast cancer ( ) Breast carcinoma ( ) Hepatocellular carcinoma ( ) Hereditary sensory and autonomic neuropathy type 1 ( ) Hypercalcaemia ( ) Leiomyoma ( ) Liver cirrhosis ( ) Malignant tumor of nasopharynx ( ) Myeloid leukaemia ( ) Nasopharyngeal carcinoma ( ) Neoplasm ( ) Neuroblastoma ( ) Obesity ( ) Pachyonychia congenita 3 ( ) Psoriasis ( ) Schizophrenia ( ) Uterine fibroids ( ) Immune system disorder ( ) Niemann-Pick disease type C ( ) Acute myelogenous leukaemia ( ) Carcinoma of liver and intrahepatic biliary tract ( ) Cervical cancer ( ) Cervical carcinoma ( ) Congenital contractural arachnodactyly ( ) leukaemia ( ) Leukemia ( ) Liver cancer ( ) Prostate cancer ( ) Prostate carcinoma ( ) Rheumatoid arthritis ( ) Secondary hyperparathyroidism ( )
UniProt ID	OSCP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10188
Sequence	MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRK FMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKD VLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLH IRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPA PKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLA RLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELA RIMGEFEITEQPRLSTSKGDDLLAMMDEL
Function	May be involved in drug clearance in the placenta.
Tissue Specificity	Expressed predominantly in testis, also found in placenta and to a lesser extent in thymus and small intestine; abundantly expressed in tumor-derived cell lines . Ubiquitously expressed .

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Chondrosarcoma	DIS4I7JB	Definitive	Biomarker	[1]
Holoprosencephaly	DISR35EC	Definitive	Genetic Variation	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[3]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
B-cell neoplasm	DISVY326	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[9]
Hereditary sensory and autonomic neuropathy type 1	DISLSPO4	Strong	Biomarker	[10]
Hypercalcaemia	DISKQ2K7	Strong	Biomarker	[11]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[12]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[13]
Malignant tumor of nasopharynx	DISTGIGF	Strong	Biomarker	[14]
Myeloid leukaemia	DISMN944	Strong	Altered Expression	[15]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Posttranslational Modification	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[16]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[17]
Obesity	DIS47Y1K	Strong	Biomarker	[18]
Pachyonychia congenita 3	DISZLC6C	Strong	Biomarker	[11]
Psoriasis	DIS59VMN	Strong	Biomarker	[19]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[20]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[12]
Immune system disorder	DISAEGPH	moderate	Biomarker	[21]
Niemann-Pick disease type C	DIS492ZO	moderate	Altered Expression	[22]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[4]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[23]
Cervical cancer	DISFSHPF	Limited	Biomarker	[24]
Cervical carcinoma	DIST4S00	Limited	Biomarker	[24]
Congenital contractural arachnodactyly	DISOM1K7	Limited	Biomarker	[25]
leukaemia	DISS7D1V	Limited	Biomarker	[4]
Leukemia	DISNAKFL	Limited	Biomarker	[4]
Liver cancer	DISDE4BI	Limited	Biomarker	[23]
Prostate cancer	DISF190Y	Limited	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[24]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[26]
Secondary hyperparathyroidism	DISZX24B	Limited	Biomarker	[27]
------------------------------------------------------------------------------------


⏷ Show the Full List of 39 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein OSCP1 (OSCP1).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein OSCP1 (OSCP1).	[29]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein OSCP1 (OSCP1).	[31]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Protein OSCP1 (OSCP1).	[32]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein OSCP1 (OSCP1).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein OSCP1 (OSCP1).	[35]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein OSCP1 (OSCP1).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein OSCP1 (OSCP1).	[38]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein OSCP1 (OSCP1).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein OSCP1 (OSCP1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein OSCP1 (OSCP1).	[36]
------------------------------------------------------------------------------------

References

1	Coexpression of NOR1 and SIX3 proteins in extraskeletal myxoid chondrosarcomas without detectable NR4A3 fusion genes.Cancer Genet Cytogenet. 2004 Jul 15;152(2):101-7. doi: 10.1016/j.cancergencyto.2003.11.011.
2	Functional characterization of SIX3 homeodomain mutations in holoprosencephaly: interaction with the nuclear receptor NR4A3/NOR1.Hum Mutat. 2004 Dec;24(6):502-8. doi: 10.1002/humu.20102.
3	Deletion of the NR4A nuclear receptor NOR1 in hematopoietic stem cells reduces inflammation but not abdominal aortic aneurysm formation.BMC Cardiovasc Disord. 2017 Oct 18;17(1):271. doi: 10.1186/s12872-017-0701-4.
4	HDAC inhibition by SNDX-275 (Entinostat) restores expression of silenced leukemia-associated transcription factors Nur77 and Nor1 and of key pro-apoptotic proteins in AML.Leukemia. 2013 Jun;27(6):1358-68. doi: 10.1038/leu.2012.366. Epub 2012 Dec 18.
5	The NOR1/OSCP1 proteins in cancer: from epigenetic silencing to functional characterization of a novel tumor suppressor.J Cancer. 2017 Feb 25;8(4):626-635. doi: 10.7150/jca.17579. eCollection 2017.
6	Deficiency of the NR4A orphan nuclear receptor NOR1 in hematopoietic stem cells accelerates atherosclerosis.Stem Cells. 2014 Sep;32(9):2419-29. doi: 10.1002/stem.1747.
7	B cell lymphoma 2 (Bcl-2) residues essential for Bcl-2's apoptosis-inducing interaction with Nur77/Nor-1 orphan steroid receptors.J Biol Chem. 2018 Mar 30;293(13):4724-4734. doi: 10.1074/jbc.RA117.001101. Epub 2018 Feb 2.
8	Early induction of the orphan nuclear receptor NOR-1 during cell death of the human breast cancer cell line MCF-7.Mol Cell Endocrinol. 2000 Apr 25;162(1-2):151-6. doi: 10.1016/s0303-7207(00)00222-7.
9	NOR1 expression and its relationship with prognosis in patients with hepatocellular carcinoma.J BUON. 2017 Sep-Oct;22(5):1186-1190.
10	A YAC-based transcript map of human chromosome 9q22.1-q22.3 encompassing the loci for hereditary sensory neuropathy type I and multiple self-healing squamous epithelioma.Genomics. 1998 Jul 15;51(2):277-81. doi: 10.1006/geno.1998.5373.
11	The in vitro evaluation of 25-hydroxyvitamin D3 and 19-nor-1alpha,25-dihydroxyvitamin D2 as therapeutic agents for prostate cancer.Clin Cancer Res. 2000 Mar;6(3):901-8.
12	Expression profiling of nuclear receptors identifies key roles of NR4A subfamily in uterine fibroids.Mol Endocrinol. 2013 May;27(5):726-40. doi: 10.1210/me.2012-1305. Epub 2013 Apr 2.
13	Oxidored-nitro domain-containing protein 1 promotes liver fibrosis by activating the Wnt/-catenin signaling pathway invitro.Mol Med Rep. 2017 Oct;16(4):5050-5054. doi: 10.3892/mmr.2017.7165. Epub 2017 Aug 4.
14	Tumor suppressor gene Oxidored-nitro domain-containing protein 1 regulates nasopharyngeal cancer cell autophagy, metabolism, and apoptosis in vitro.Int J Biochem Cell Biol. 2013 Sep;45(9):2016-26. doi: 10.1016/j.biocel.2013.06.020. Epub 2013 Jul 3.
15	19-Nor-1,25(OH)2D2 (a novel, noncalcemic vitamin D analogue), combined with arsenic trioxide, has potent antitumor activity against myeloid leukemia. Cancer Res. 2005 Mar 15;65(6):2488-97.
16	Abberent expression of NOR1 protein in tumor associated macrophages contributes to the development of DEN-induced hepatocellular carcinoma.J Cell Physiol. 2018 Jun;233(6):5002-5013. doi: 10.1002/jcp.26349. Epub 2018 Jan 4.
17	Expression of NOR-1 and its closely related members of the steroid/thyroid hormone receptor superfamily in human neuroblastoma cell lines.Cancer Lett. 1995 Sep 4;96(1):117-22. doi: 10.1016/0304-3835(95)03921-i.
18	The nuclear receptors NUR77, NURR1 and NOR1 in obesity and during fat loss.Int J Obes (Lond). 2012 Sep;36(9):1195-202. doi: 10.1038/ijo.2011.240. Epub 2011 Dec 6.
19	Dimethyl fumarate and vitamin D derivatives cooperatively enhance VDR and Nrf2 signaling in differentiating AML cells in vitro and inhibit leukemia progression in a xenograft mouse model.J Steroid Biochem Mol Biol. 2019 Apr;188:8-16. doi: 10.1016/j.jsbmb.2018.11.017. Epub 2018 Nov 30.
20	Genome-wide association study of paliperidone efficacy.Pharmacogenet Genomics. 2017 Jan;27(1):7-18. doi: 10.1097/FPC.0000000000000250.
21	The NR4A nuclear receptor family in eosinophils.J Hum Genet. 2007;52(1):13-20. doi: 10.1007/s10038-006-0085-2. Epub 2006 Nov 10.
22	Oxidored-nitro domain containing protein 1 (NOR1) expression suppresses slug/vimentin but not snail in nasopharyngeal carcinoma: Inhibition of EMT in vitro and in vivo in mice.Cancer Lett. 2014 Jun 28;348(1-2):109-18. doi: 10.1016/j.canlet.2014.03.005. Epub 2014 Mar 18.
23	NOR1 promotes hepatocellular carcinoma cell proliferation and migration through modulating the Notch signaling pathway.Exp Cell Res. 2017 Mar 15;352(2):375-381. doi: 10.1016/j.yexcr.2017.02.032. Epub 2017 Feb 21.
24	Overexpression of oxidored-nitro domain containing protein 1 induces growth inhibition and apoptosis in human prostate cancer PC3 cells.Oncol Rep. 2014 Nov;32(5):1939-46. doi: 10.3892/or.2014.3407. Epub 2014 Aug 14.
25	Overexpression of oxidored-nitro domain containing protein 1 inhibits human nasopharyngeal carcinoma and cervical cancer cell proliferation and induces apoptosis: Involvement of mitochondrial apoptotic pathways.Oncol Rep. 2013 Jan;29(1):79-86. doi: 10.3892/or.2012.2101. Epub 2012 Oct 23.
26	Activation of nuclear orphan receptor NURR1 transcription by NF-kappa B and cyclic adenosine 5'-monophosphate response element-binding protein in rheumatoid arthritis synovial tissue.J Immunol. 2002 Mar 15;168(6):2979-87. doi: 10.4049/jimmunol.168.6.2979.
27	Oral paricalcitol: expanding therapeutic options for pediatric chronic kidney disease patients.Pediatr Nephrol. 2017 Jul;32(7):1103-1108. doi: 10.1007/s00467-017-3675-7. Epub 2017 Apr 27.
28	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
29	Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
30	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
31	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
32	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
33	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
34	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
36	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
37	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
38	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.