General Information of Drug (ID: DMJO6GV)

Drug Name
Abciximab
Synonyms ReoPro (TN)
Indication
Disease Entry ICD 11 Status REF
Acute disease N.A. Approved [1]
Angina pectoris BA40 Approved [2]
Brain ischaemia 8B1Z Approved [3]
Therapeutic Class
Anticoagulants
Affected Organisms
Humans and other mammals
ATC Code
B01AC13: Abciximab
B01AC: Platelet aggregation inhibitors excl. heparin
B01A: ANTITHROMBOTIC AGENTS
B01: ANTITHROMBOTIC AGENTS
B: BLOOD AND BLOOD FORMING ORGANS
Drug Type
Monoclonal antibody
Sequence
>heavy chain 1
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 1
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>heavy chain 2
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 2
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in less than 10 minutes [4]
Metabolism
The drug is metabolized via opsonization via the reticuloendothelial system []
Adverse Drug Reaction (ADR)
ADR Term Variation Related DOT DOT ID REF
Surgical and medical procedures Not Available ITGA2B OT4Y17PY [5]
Surgical and medical procedures Not Available ITGB3 OTWCK1K6 [5]
Cross-matching ID
UNII
X85G7936GV
DrugBank ID
DB00054
TTD ID
D0P3TX
Combinatorial Drugs (CBD) Click to Jump to the Detailed CBD Information of This Drug
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Glycoprotein IIb/IIIa receptor (GPIIb/IIIa) TT38RM1 ITA2B_HUMAN ; ITB3_HUMAN Modulator [6]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Integrin alpha-IIb (ITGA2B) OT4Y17PY ITA2B_HUMAN Drug Response [5]
Integrin beta-3 (ITGB3) OTWCK1K6 ITB3_HUMAN Drug Response [5]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Acute disease
ICD Disease Classification
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Glycoprotein IIb/IIIa receptor (GPIIb/IIIa) DTT ITGA2B; ITGB3 7.83E-01 -0.11 -0.45
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Abciximab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Vitamin E DMZC90K Moderate Increased risk of bleeding by the combination of Abciximab and Vitamin E. Cardiovascular disease [BA00-BE2Z] [7]
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Abciximab and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [8]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Abciximab and Pentosan polysulfate. Chronic pain [MG30] [9]
Phenylbutazone DMAYL0T Moderate Increased risk of bleeding by the combination of Abciximab and Phenylbutazone. Chronic pain [MG30] [10]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Abciximab and Ketoprofen. Chronic pain [MG30] [10]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Abciximab and Levomilnacipran. Chronic pain [MG30] [11]
Anisindione DM2C48U Major Increased risk of bleeding by the combination of Abciximab and Anisindione. Coagulation defect [3B10] [10]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Abciximab and Regorafenib. Colorectal cancer [2B91] [12]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Abciximab and Intedanib. Colorectal cancer [2B91] [13]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Abciximab and Ardeparin. Coronary thrombosis [BA43] [14]
Danaparoid DM6CLBN Major Increased risk of bleeding by the combination of Abciximab and Danaparoid. Deep vein thrombosis [BD71] [14]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Abciximab and Rivaroxaban. Deep vein thrombosis [BD71] [15]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Abciximab and Sertraline. Depression [6A70-6A7Z] [11]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Abciximab and Vilazodone. Depression [6A70-6A7Z] [11]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Abciximab and Paroxetine. Depression [6A70-6A7Z] [11]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Abciximab and Vortioxetine. Depression [6A70-6A7Z] [11]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Abciximab and Duloxetine. Depression [6A70-6A7Z] [11]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Abciximab and Milnacipran. Depression [6A70-6A7Z] [11]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Abciximab and Escitalopram. Depression [6A70-6A7Z] [11]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Abciximab and Desvenlafaxine. Depression [6A70-6A7Z] [11]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Abciximab and Clomipramine. Depression [6A70-6A7Z] [11]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Abciximab and Fluvoxamine. Depression [6A70-6A7Z] [11]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Abciximab and Venlafaxine. Depression [6A70-6A7Z] [11]
Heme DMGC287 Moderate Increased risk of bleeding by the combination of Abciximab and Heme. Discovery agent [N.A.] [16]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Abciximab and Apigenin. Discovery agent [N.A.] [17]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Abciximab and Citalopram derivative 1. Discovery agent [N.A.] [11]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Abciximab and PMID28870136-Compound-49. Discovery agent [N.A.] [18]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Abciximab and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [11]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Abciximab and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [19]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Abciximab and Mefenamic acid. Female pelvic pain [GA34] [10]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Abciximab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [12]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Abciximab and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [20]
Dipyridamole DMXY30O Major Increased risk of bleeding by the combination of Abciximab and Dipyridamole. Hypertension [BA00-BA04] [21]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Abciximab and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [10]
Ticlopidine DMO946V Major Increased risk of bleeding by the combination of Abciximab and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [21]
Tositumomab DMMYZ3D Major Increased risk of bleeding by the combination of Abciximab and Tositumomab. Malignant haematopoietic neoplasm [2B33] [22]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Abciximab and Acalabrutinib. Mature B-cell lymphoma [2A85] [23]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Abciximab and Ibrutinib. Mature B-cell lymphoma [2A85] [24]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Abciximab and Ponatinib. Mature B-cell lymphoma [2A85] [25]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Abciximab and Panobinostat. Multiple myeloma [2A83] [26]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Abciximab and Dasatinib. Myeloproliferative neoplasm [2A20] [27]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Abciximab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [9]
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Abciximab and Prasugrel. Myocardial infarction [BA41-BA43] [21]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Abciximab and Vorapaxar. Myocardial infarction [BA41-BA43] [28]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Abciximab and Sibutramine. Obesity [5B80-5B81] [11]
Dexfenfluramine DMJ7YDS Moderate Increased risk of bleeding by the combination of Abciximab and Dexfenfluramine. Obesity [5B80-5B81] [11]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Abciximab and Diclofenac. Osteoarthritis [FA00-FA05] [10]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Abciximab and Nepafenac. Osteoarthritis [FA00-FA05] [19]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Abciximab and Naproxen. Osteoarthritis [FA00-FA05] [10]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Abciximab and MK-4827. Ovarian cancer [2C73] [12]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Abciximab and Aspirin. Pain [MG30-MG3Z] [29]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Abciximab and Etodolac. Pain [MG30-MG3Z] [10]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Abciximab and Diflunisal. Pain [MG30-MG3Z] [29]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Abciximab and Ibuprofen. Pain [MG30-MG3Z] [10]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Abciximab and Nabumetone. Pain [MG30-MG3Z] [10]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Abciximab and Piroxicam. Pain [MG30-MG3Z] [10]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Abciximab and Choline salicylate. Postoperative inflammation [1A00-CA43] [29]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Abciximab and Ketorolac. Postoperative inflammation [1A00-CA43] [10]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Abciximab and Bromfenac. Postoperative inflammation [1A00-CA43] [19]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Abciximab and Epoprostenol. Pulmonary hypertension [BB01] [30]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Abciximab and Iloprost. Pulmonary hypertension [BB01] [30]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Abciximab and Salsalate. Rheumatoid arthritis [FA20] [29]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Abciximab and Meloxicam. Rheumatoid arthritis [FA20] [10]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Abciximab and Sulindac. Rheumatoid arthritis [FA20] [10]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Abciximab and Oxaprozin. Rheumatoid arthritis [FA20] [10]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Abciximab and Flurbiprofen. Rheumatoid arthritis [FA20] [19]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Abciximab and Fenoprofen. Rheumatoid arthritis [FA20] [10]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Abciximab and Indomethacin. Rheumatoid arthritis [FA20] [10]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Abciximab and Tolmetin. Rheumatoid arthritis [FA20] [10]
Salicyclic acid DM2F8XZ Moderate Increased risk of bleeding by the combination of Abciximab and Salicyclic acid. Seborrhoeic dermatitis [EA81] [29]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Abciximab and Curcumin. Solid tumour/cancer [2A00-2F9Z] [31]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Abciximab and Warfarin. Supraventricular tachyarrhythmia [BC81] [10]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Abciximab and Caplacizumab. Thrombocytopenia [3B64] [26]
Anagrelide DMSQ8MD Major Increased risk of bleeding by the combination of Abciximab and Anagrelide. Thrombocytosis [3B63] [10]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Abciximab and Apixaban. Thrombosis [DB61-GB90] [12]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Abciximab and Cangrelor. Thrombosis [DB61-GB90] [12]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Abciximab and Brilinta. Thrombosis [DB61-GB90] [12]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Abciximab and Argatroban. Thrombosis [DB61-GB90] [32]
Dicumarol DMFQCB1 Major Increased risk of bleeding by the combination of Abciximab and Dicumarol. Thrombosis [DB61-GB90] [33]
Clopidogrel DMOL54H Major Increased risk of bleeding by the combination of Abciximab and Clopidogrel. Thrombosis [DB61-GB90] [21]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Abciximab and Cabozantinib. Thyroid cancer [2D10] [34]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Abciximab and Betrixaban. Venous thromboembolism [BD72] [35]
⏷ Show the Full List of 82 DDI Information of This Drug

References

1 Diagnosis, treatment, and long-term management of Kawasaki disease: a statement for health professionals from the Committee on Rheumatic Fever, Endocarditis and Kawasaki Disease, Council on Cardiovascular Disease in the Young, American Heart Association. Circulation. 2004 Oct 26;110(17):2747-71.
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6584).
3 Emergent carotid stenting and intra-arterial abciximab in acute ischemic stroke due to tandem occlusion. Br J Neurosurg. 2017 Oct;31(5):573-579.
4 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
6 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
7 Booth SL, Golly I, Sacheck JM, Roubenoff R, Dallal GE, et al "Effect of vitamin E supplementation on vitamin K status in adults with normal coagulation status." Am J Clin Nutr 80 (2004): 143-8. [PMID: 15213041]
8 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
9 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
10 Product Information. Integrilin (eptifibatide). Schering Laboratories, Kenilworth, NJ.
11 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
12 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
13 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
14 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
15 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
16 Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
17 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
18 Canadian Pharmacists Association.
19 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
20 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
21 Klinkhardt U, Kirchmaier CM, Westrup D, Graff J, Mahnel R, Breddin HK, Harder S "Ex vivo-in vitro interaction between aspirin, clopidogrel, and the glycoprotein IIb/IIIa inhibitors abciximab and SR121566A." Clin Pharmacol Ther 67 (2000): 305-13. [PMID: 10741635]
22 Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
23 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
24 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
25 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
26 Cerner Multum, Inc. "Australian Product Information.".
27 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
28 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
29 Hirsch J, Dalen J, Guyatt G, American College of Chest Physicians "The sixth (2000) ACCP guidelines for antithrombotic therapy for prevention and treatment of thrombosis. American College of Physicians." Chest 119(1 Suppl) (2001): 1S-2S. [PMID: 11157638]
30 Product Information. Flolan (epoprostenol). Glaxo Wellcome, Research Triangle Park, NC.
31 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
32 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
33 Guo LQ, Yamazoe Y "Inhibition of cytochrome P450 by furanocoumarins in grapefruit juice and herbal medicines." Acta Pharmacol Sin 25 (2004): 129-36. [PMID: 14769198]
34 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
35 Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.