Details of the Drug

General Information of Drug (ID: DMMHR1U)

Drug Name
Denileukin diftitox
Indication
Disease Entry ICD 11 Status REF
Epithelial ovarian cancer 2B5D Approved [1]
leukaemia 2A60-2B33 Approved [2]
Plasma cell myeloma 2A83.1 Approved [1]
Primary cutaneous T-cell lymphoma N.A. Approved [3]
Non-small-cell lung cancer 2C25.Y Phase 2 [2]
Therapeutic Class
Anticancer Agents
Affected Organisms
Humans and other mammals
ATC Code
L01XX29: Denileukin diftitox
L01XX: Other antineoplastic agents
L01X: OTHER ANTINEOPLASTIC AGENTS
L01: ANTINEOPLASTIC AGENTS
L: ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
Sequence
MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNK
YDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVG
TEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMY
EYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVS
EEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEK
TTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYN
FVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYK
NPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVI
VLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT
ADMET Property
Clearance
The clearance of drug is 0.6-2.0 mL/min/kg []
Half-life
The concentration or amount of drug in body reduced by one-half in 70 - 80 minutes [4]
Vd
The volume of distribution (Vd) of drug is 0.06-0.09 L/kg []
Cross-matching ID
UNII
25E79B5CTM
DrugBank ID
DB00004
TTD ID
D0J3RY
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interleukin 2 receptor (IL2R) TTAJU0S NOUNIPROTAC Binder [5]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Denileukin diftitox (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Roflumilast. Asthma [CA23] [6]
Ofloxacin DM0VQN3 Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Ofloxacin. Bacterial infection [1A00-1C4Z] [7]
Ciprofloxacin XR DM2NLS9 Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Ciprofloxacin XR. Bacterial infection [1A00-1C4Z] [7]
Trovafloxacin DM6AN32 Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Trovafloxacin. Bacterial infection [1A00-1C4Z] [7]
Sparfloxacin DMB4HCT Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Sparfloxacin. Bacterial infection [1A00-1C4Z] [7]
Gemifloxacin DMHT34O Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Gemifloxacin. Bacterial infection [1A00-1C4Z] [7]
Norfloxacin DMIZ6W2 Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Norfloxacin. Bacterial infection [1A00-1C4Z] [7]
ABT-492 DMJFD2I Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by ABT-492. Bacterial infection [1A00-1C4Z] [7]
Levofloxacin DMS60RB Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Levofloxacin. Bacterial infection [1A00-1C4Z] [7]
Moxifloxacin DMU8V4S Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Moxifloxacin. Bacterial infection [1A00-1C4Z] [7]
Lomefloxacin DMVRH9C Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Lomefloxacin. Bacterial infection [1A00-1C4Z] [7]
Grepafloxacin DMGLX0T Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Grepafloxacin. Bronchitis [CA20] [7]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Teriflunomide. Hyper-lipoproteinaemia [5C80] [8]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Denosumab. Low bone mass disorder [FB83] [9]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Cladribine. Mature B-cell leukaemia [2A82] [6]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Alemtuzumab. Mature B-cell leukaemia [2A82] [10]
Thalidomide DM70BU5 Major Additive thrombogenic effects by the combination of Denileukin diftitox and Thalidomide. Multiple myeloma [2A83] [11]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Tecfidera. Multiple sclerosis [8A40] [12]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Siponimod. Multiple sclerosis [8A40] [13]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Fingolimod. Multiple sclerosis [8A40] [14]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Ocrelizumab. Multiple sclerosis [8A40] [15]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Ozanimod. Multiple sclerosis [8A40] [6]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [16]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Efalizumab. Psoriasis [EA90] [17]
Infliximab DMH7OIA Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Infliximab. Psoriasis [EA90] [18]
Gatifloxacin DMSL679 Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Gatifloxacin. Respiratory infection [CA07-CA4Z] [7]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Canakinumab. Rheumatoid arthritis [FA20] [19]
Etanercept DMCV109 Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Etanercept. Rheumatoid arthritis [FA20] [18]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Rilonacept. Rheumatoid arthritis [FA20] [19]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Golimumab. Rheumatoid arthritis [FA20] [18]
Adalimumab DMQMV1B Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Adalimumab. Rheumatoid arthritis [FA20] [18]
Leflunomide DMR8ONJ Major Additive immunosuppressive effects by the combination of Denileukin diftitox and Leflunomide. Rheumatoid arthritis [FA20] [8]
Anakinra DMU8KOD Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Anakinra. Rheumatoid arthritis [FA20] [19]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Denileukin diftitox when combined with Anthrax vaccine. Sepsis [1G40-1G41] [20]
Azathioprine DMMZSXQ Moderate Additive immunosuppressive effects by the combination of Denileukin diftitox and Azathioprine. Transplant rejection [NE84] [13]
Cinoxacin DM4EWNS Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Cinoxacin. Urinary tract infection [GC08] [7]
Nalidixic acid DMRM0JV Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Nalidixic acid. Urinary tract infection [GC08] [7]
Enoxacin DMYTE6L Minor Decreased absorption of Denileukin diftitox due to intestinal mucosa variation caused by Enoxacin. Urinary tract infection [GC08] [7]
Ganciclovir DM1MBYQ Moderate Increased risk of nephrotoxicity by the combination of Denileukin diftitox and Ganciclovir. Virus infection [1A24-1D9Z] [13]
Valganciclovir DMS2IUH Moderate Increased risk of nephrotoxicity by the combination of Denileukin diftitox and Valganciclovir. Virus infection [1A24-1D9Z] [13]
⏷ Show the Full List of 40 DDI Information of This Drug

References

1 A standard database for drug repositioning. Sci Data. 2017 Mar 14;4:170029.
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7044).
3 Advanced-stage primary cutaneous T-cell lymphoma treated with bexarotene and denileukin diftitox. Case Rep Dermatol. 2011 Jan;3(1):13-7.
4 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5 Optimizing denileukin diftitox (Ontak) therapy. Future Oncol. 2008 Aug;4(4):457-69.
6 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
7 Johnson EJ, MacGowan AP, Potter MN, et al "Reduced absorption of oral ciprofloxacin after chemotherapy for haematological malignancy." J Antimicrob Chemother 25 (1990): 837-42. [PMID: 2373666]
8 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
9 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
10 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
11 Bennett CL, Nebeker JR, Samore MH, et al "The Research on Adverse Drug Events and Reports (RADAR) project." JAMA 293 (2005): 2131-40. [PMID: 15870417]
12 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
13 Cerner Multum, Inc. "Australian Product Information.".
14 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
15 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
16 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
17 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
18 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
19 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
20 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]