Details of the Drug

General Information of Drug (ID: DMCKL5V)

Drug Name
Efalizumab
Synonyms Raptiva; Raptiva (TN); Efalizumab (USAN/INN)
Indication
Disease Entry ICD 11 Status REF
Psoriasis vulgaris EA90 Approved [1]
Renal transplantation NE84 Phase 2 [1]
Therapeutic Class
Immunomodulatory Agents
Affected Organisms
Humans and other mammals
ATC Code
L04AA21: Efalizumab
L04AA: Selective immunosuppressants
L04A: IMMUNOSUPPRESSANTS
L04: IMMUNOSUPPRESSANTS
L: ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
Drug Type
Antibody
Sequence
>heavy chain variable region
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGIMIHPSDSETR
YNQKFKDIRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARIGIYFYGTTYFDYIWGQGTL
VTVSS
>light chain variable region
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWXQQKPGKAPKLLIYSGSTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKR
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 5 days [2]
Cross-matching ID
UNII
XX2MN88N5D
DrugBank ID
DB00095
TTD ID
D03SGR
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Integrin alpha-L (ITGAL) TT48WR6 ITAL_HUMAN Not Available [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Psoriasis vulgaris
ICD Disease Classification EA90
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Integrin alpha-L (ITGAL) DTT ITGAL 1.20E-33 0.79 2.12
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Efalizumab
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Brodalumab DMASDQ6 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Brodalumab. Psoriasis [EA90] [4]
Ustekinumab DMHTYK3 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Ustekinumab. Psoriasis [EA90] [4]
Tildrakizumab DMLW9HG Moderate Additive immunosuppressive effects by the combination of Efalizumab and Tildrakizumab. Psoriasis [EA90] [4]
Risankizumab DMM32GT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Risankizumab. Psoriasis [EA90] [4]
Ixekizumab DMXW92T Moderate Additive immunosuppressive effects by the combination of Efalizumab and Ixekizumab. Psoriasis [EA90] [4]
Coadministration of a Drug Treating the Disease Different from Efalizumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Thioguanine DM7NKEV Moderate Additive immunosuppressive effects by the combination of Efalizumab and Thioguanine. Acute myeloid leukaemia [2A60] [4]
Midostaurin DMI6E0R Moderate Additive immunosuppressive effects by the combination of Efalizumab and Midostaurin. Acute myeloid leukaemia [2A60] [4]
Idarubicin DMM0XGL Moderate Additive immunosuppressive effects by the combination of Efalizumab and Idarubicin. Acute myeloid leukaemia [2A60] [4]
Daunorubicin DMQUSBT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Daunorubicin. Acute myeloid leukaemia [2A60] [4]
Siltuximab DMGEATB Moderate Additive immunosuppressive effects by the combination of Efalizumab and Siltuximab. Anemia [3A00-3A9Z] [4]
Budesonide DMJIBAW Moderate Additive immunosuppressive effects by the combination of Efalizumab and Budesonide. Asthma [CA23] [4]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Roflumilast. Asthma [CA23] [5]
Dupilumab DMOAD2Y Moderate Additive immunosuppressive effects by the combination of Efalizumab and Dupilumab. Atopic eczema [EA80] [4]
Linezolid DMGFPU2 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Linezolid. Bacterial infection [1A00-1C4Z] [4]
Temozolomide DMKECZD Moderate Additive myelosuppressive effects by the combination of Efalizumab and Temozolomide. Brain cancer [2A00] [4]
Lomustine DMMWSUL Moderate Additive immunosuppressive effects by the combination of Efalizumab and Lomustine. Brain cancer [2A00] [4]
Eribulin DM1DX4Q Moderate Additive myelosuppressive effects by the combination of Efalizumab and Eribulin. Breast cancer [2C60-2C6Y] [4]
Talazoparib DM1KS78 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Talazoparib. Breast cancer [2C60-2C6Y] [4]
Ixabepilone DM2OZ3G Moderate Additive immunosuppressive effects by the combination of Efalizumab and Ixabepilone. Breast cancer [2C60-2C6Y] [4]
LY2835219 DM93VBZ Moderate Additive myelosuppressive effects by the combination of Efalizumab and LY2835219. Breast cancer [2C60-2C6Y] [4]
Pralatrexate DMAO80I Moderate Additive myelosuppressive effects by the combination of Efalizumab and Pralatrexate. Breast cancer [2C60-2C6Y] [4]
Palbociclib DMD7L94 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Palbociclib. Breast cancer [2C60-2C6Y] [4]
Mitomycin DMH0ZJE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Mitomycin. Breast cancer [2C60-2C6Y] [4]
Thiotepa DMIZKOP Moderate Additive myelosuppressive effects by the combination of Efalizumab and Thiotepa. Breast cancer [2C60-2C6Y] [4]
Cabazitaxel DMPAZHC Moderate Additive immunosuppressive effects by the combination of Efalizumab and Cabazitaxel. Breast cancer [2C60-2C6Y] [4]
Bosutinib DMTI8YE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Bosutinib. Breast cancer [2C60-2C6Y] [4]
Corticotropin DMP9TWZ Moderate Additive immunosuppressive effects by the combination of Efalizumab and Corticotropin. Chronic kidney disease [GB61] [4]
Irinotecan DMP6SC2 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Irinotecan. Colorectal cancer [2B91] [4]
Oxaliplatin DMQNWRD Moderate Additive myelosuppressive effects by the combination of Efalizumab and Oxaliplatin. Colorectal cancer [2B91] [4]
Aflibercept DMT3D5I Moderate Additive immunosuppressive effects by the combination of Efalizumab and Aflibercept. Colorectal cancer [2B91] [4]
Capecitabine DMTS85L Moderate Additive immunosuppressive effects by the combination of Efalizumab and Capecitabine. Colorectal cancer [2B91] [4]
Mycophenolic acid DMRBMAU Moderate Additive immunosuppressive effects by the combination of Efalizumab and Mycophenolic acid. Crohn disease [DD70] [4]
Polatuzumab vedotin DMF6Y0L Moderate Additive myelosuppressive effects by the combination of Efalizumab and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [4]
Axicabtagene ciloleucel DMYHN59 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [4]
Bay 80-6946 DMLOS5R Moderate Additive immunosuppressive effects by the combination of Efalizumab and Bay 80-6946. Follicular lymphoma [2A80] [4]
Avapritinib DMK2GZX Moderate Additive immunosuppressive effects by the combination of Efalizumab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [4]
177Lu-DOTATATE DMT8GVU Moderate Additive myelosuppressive effects by the combination of Efalizumab and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [4]
Procarbazine DMIK367 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Procarbazine. Hodgkin lymphoma [2B30] [4]
Bleomycin DMNER5S Moderate Additive immunosuppressive effects by the combination of Efalizumab and Bleomycin. Hodgkin lymphoma [2B30] [4]
Brentuximab vedotin DMWLC57 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [4]
Zidovudine DM4KI7O Moderate Additive immunosuppressive effects by the combination of Efalizumab and Zidovudine. Human immunodeficiency virus disease [1C60-1C62] [4]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Efalizumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [6]
Fludrocortisone DMUDIR8 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Fludrocortisone. Hypo-osmolality/hyponatraemia [5C72] [4]
Olaratumab DMNYOIX Moderate Additive immunosuppressive effects by the combination of Efalizumab and Olaratumab. Kaposi sarcoma [2B57] [4]
Methotrexate DM2TEOL Moderate Additive myelosuppressive effects by the combination of Efalizumab and Methotrexate. Leukaemia [2A60-2B33] [4]
Nelarabine DMB6VEG Moderate Additive myelosuppressive effects by the combination of Efalizumab and Nelarabine. Leukaemia [2A60-2B33] [4]
DTI-015 DMXZRW0 Moderate Additive myelosuppressive effects by the combination of Efalizumab and DTI-015. Liver cancer [2C12] [4]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Efalizumab and Denosumab. Low bone mass disorder [FB83] [7]
Brigatinib DM7W94S Moderate Additive immunosuppressive effects by the combination of Efalizumab and Brigatinib. Lung cancer [2C25] [4]
Lurbinectedin DMEFRTZ Moderate Additive immunosuppressive effects by the combination of Efalizumab and Lurbinectedin. Lung cancer [2C25] [4]
Osimertinib DMRJLAT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Osimertinib. Lung cancer [2C25] [4]
Belimumab DM3OBQF Moderate Additive immunosuppressive effects by the combination of Efalizumab and Belimumab. Lupus erythematosus [4A40] [4]
Inotuzumab ozogamicin DMAC130 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Inotuzumab ozogamicin. Malignant haematopoietic neoplasm [2B33] [4]
Fludarabine DMVRLT7 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Fludarabine. Malignant haematopoietic neoplasm [2B33] [4]
Ofatumumab DM295PR Moderate Additive myelosuppressive effects by the combination of Efalizumab and Ofatumumab. Mature B-cell leukaemia [2A82] [4]
Obinutuzumab DM3BVAE Moderate Additive myelosuppressive effects by the combination of Efalizumab and Obinutuzumab. Mature B-cell leukaemia [2A82] [4]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Efalizumab and Cladribine. Mature B-cell leukaemia [2A82] [5]
Idelalisib DM602WT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Idelalisib. Mature B-cell leukaemia [2A82] [4]
GDC-0199 DMH0QKA Moderate Additive myelosuppressive effects by the combination of Efalizumab and GDC-0199. Mature B-cell leukaemia [2A82] [4]
Chlorambucil DMRKE63 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Chlorambucil. Mature B-cell leukaemia [2A82] [4]
IPI-145 DMWA24P Moderate Additive immunosuppressive effects by the combination of Efalizumab and IPI-145. Mature B-cell leukaemia [2A82] [4]
Acalabrutinib DM7GCVW Moderate Additive myelosuppressive effects by the combination of Efalizumab and Acalabrutinib. Mature B-cell lymphoma [2A85] [4]
Clofarabine DMCVJ86 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Clofarabine. Mature B-cell lymphoma [2A85] [4]
Blinatumomab DMGECIJ Moderate Additive immunosuppressive effects by the combination of Efalizumab and Blinatumomab. Mature B-cell lymphoma [2A85] [4]
Ibrutinib DMHZCPO Moderate Additive immunosuppressive effects by the combination of Efalizumab and Ibrutinib. Mature B-cell lymphoma [2A85] [4]
Vincristine DMINOX3 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Vincristine. Mature B-cell lymphoma [2A85] [4]
Teniposide DMLW57T Moderate Additive immunosuppressive effects by the combination of Efalizumab and Teniposide. Mature B-cell lymphoma [2A85] [4]
Tisagenlecleucel DMM9BJD Moderate Additive immunosuppressive effects by the combination of Efalizumab and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [4]
Mercaptopurine DMTM2IK Moderate Additive immunosuppressive effects by the combination of Efalizumab and Mercaptopurine. Mature B-cell lymphoma [2A85] [4]
Ponatinib DMYGJQO Moderate Additive myelosuppressive effects by the combination of Efalizumab and Ponatinib. Mature B-cell lymphoma [2A85] [4]
Cytarabine DMZD5QR Moderate Additive immunosuppressive effects by the combination of Efalizumab and Cytarabine. Mature B-cell lymphoma [2A85] [4]
Mechlorethamine DM0CVXA Moderate Additive immunosuppressive effects by the combination of Efalizumab and Mechlorethamine. Mature T-cell lymphoma [2A90] [4]
Dacarbazine DMNPZL4 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Dacarbazine. Melanoma [2C30] [4]
Carfilzomib DM48K0X Moderate Additive myelosuppressive effects by the combination of Efalizumab and Carfilzomib. Multiple myeloma [2A83] [4]
Panobinostat DM58WKG Moderate Additive immunosuppressive effects by the combination of Efalizumab and Panobinostat. Multiple myeloma [2A83] [4]
Lenalidomide DM6Q7U4 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Lenalidomide. Multiple myeloma [2A83] [4]
Thalidomide DM70BU5 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Thalidomide. Multiple myeloma [2A83] [4]
Selinexor DMBD4K3 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Selinexor. Multiple myeloma [2A83] [4]
Belantamab mafodotin DMBT3AI Moderate Additive myelosuppressive effects by the combination of Efalizumab and Belantamab mafodotin. Multiple myeloma [2A83] [4]
Elotuzumab DMEYHG9 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Elotuzumab. Multiple myeloma [2A83] [4]
Daratumumab DMKCIUZ Moderate Additive myelosuppressive effects by the combination of Efalizumab and Daratumumab. Multiple myeloma [2A83] [4]
Melphalan DMOLNHF Moderate Additive myelosuppressive effects by the combination of Efalizumab and Melphalan. Multiple myeloma [2A83] [4]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Tecfidera. Multiple sclerosis [8A40] [4]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Efalizumab and Siponimod. Multiple sclerosis [8A40] [8]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Efalizumab and Fingolimod. Multiple sclerosis [8A40] [9]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Efalizumab and Ozanimod. Multiple sclerosis [8A40] [5]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Efalizumab and Deflazacort. Muscular dystrophy [8C70] [4]
Bexarotene DMOBIKY Moderate Additive immunosuppressive effects by the combination of Efalizumab and Bexarotene. Mycosis fungoides [2B01] [4]
Romidepsin DMT5GNL Moderate Additive myelosuppressive effects by the combination of Efalizumab and Romidepsin. Mycosis fungoides [2B01] [4]
Decitabine DMQL8XJ Moderate Additive myelosuppressive effects by the combination of Efalizumab and Decitabine. Myelodysplastic syndrome [2A37] [4]
Azacitidine DMTA5OE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Azacitidine. Myelodysplastic syndrome [2A37] [4]
Nilotinib DM7HXWT Moderate Additive myelosuppressive effects by the combination of Efalizumab and Nilotinib. Myeloproliferative neoplasm [2A20] [4]
Ruxolitinib DM7Q98D Moderate Additive myelosuppressive effects by the combination of Efalizumab and Ruxolitinib. Myeloproliferative neoplasm [2A20] [4]
Imatinib DM7RJXL Moderate Additive myelosuppressive effects by the combination of Efalizumab and Imatinib. Myeloproliferative neoplasm [2A20] [4]
Dasatinib DMJV2EK Moderate Additive immunosuppressive effects by the combination of Efalizumab and Dasatinib. Myeloproliferative neoplasm [2A20] [4]
Hydroxyurea DMOQVU9 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Hydroxyurea. Myeloproliferative neoplasm [2A20] [4]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Efalizumab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [4]
Busulfan DMXYJ9C Moderate Additive myelosuppressive effects by the combination of Efalizumab and Busulfan. Myeloproliferative neoplasm [2A20] [4]
Inebilizumab DMI0RHA Moderate Additive immunosuppressive effects by the combination of Efalizumab and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [4]
Atezolizumab DMMF8U0 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Atezolizumab. Non-small cell lung cancer [2C25] [4]
Olaparib DM8QB1D Moderate Additive myelosuppressive effects by the combination of Efalizumab and Olaparib. Ovarian cancer [2C73] [4]
Rucaparib DM9PVX8 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Rucaparib. Ovarian cancer [2C73] [4]
Carboplatin DMG281S Moderate Additive myelosuppressive effects by the combination of Efalizumab and Carboplatin. Ovarian cancer [2C73] [4]
Altretamine DMKLAYG Moderate Additive immunosuppressive effects by the combination of Efalizumab and Altretamine. Ovarian cancer [2C73] [4]
MK-4827 DMLYGH4 Moderate Additive myelosuppressive effects by the combination of Efalizumab and MK-4827. Ovarian cancer [2C73] [4]
Topotecan DMP6G8T Moderate Additive myelosuppressive effects by the combination of Efalizumab and Topotecan. Ovarian cancer [2C73] [4]
Streptozocin DMOF7AT Moderate Additive immunosuppressive effects by the combination of Efalizumab and Streptozocin. Pancreatic cancer [2C10] [4]
Pemetrexed DMMX2E6 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Pemetrexed. Pleural mesothelioma [2C26] [4]
Prednisone DM2HG4X Moderate Additive immunosuppressive effects by the combination of Efalizumab and Prednisone. Postoperative inflammation [1A00-CA43] [4]
Betamethasone DMAHJEF Moderate Additive immunosuppressive effects by the combination of Efalizumab and Betamethasone. Postoperative inflammation [1A00-CA43] [4]
Hydrocortisone DMGEMB7 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Hydrocortisone. Postoperative inflammation [1A00-CA43] [4]
Everolimus DM8X2EH Moderate Additive myelosuppressive effects by the combination of Efalizumab and Everolimus. Renal cell carcinoma [2C90] [4]
Temsirolimus DMS104F Moderate Additive immunosuppressive effects by the combination of Efalizumab and Temsirolimus. Renal cell carcinoma [2C90] [4]
Tocilizumab DM7J6OR Moderate Additive immunosuppressive effects by the combination of Efalizumab and Tocilizumab. Rheumatoid arthritis [FA20] [4]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Canakinumab. Rheumatoid arthritis [FA20] [4]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Efalizumab and Rilonacept. Rheumatoid arthritis [FA20] [4]
Golimumab DMHZV7X Moderate Additive immunosuppressive effects by the combination of Efalizumab and Golimumab. Rheumatoid arthritis [FA20] [4]
Dexamethasone DMMWZET Moderate Additive immunosuppressive effects by the combination of Efalizumab and Dexamethasone. Rheumatoid arthritis [FA20] [4]
Sarilumab DMOGNXY Moderate Additive immunosuppressive effects by the combination of Efalizumab and Sarilumab. Rheumatoid arthritis [FA20] [4]
Leflunomide DMR8ONJ Major Additive immunosuppressive effects by the combination of Efalizumab and Leflunomide. Rheumatoid arthritis [FA20] [6]
Abatacept DMSA8RU Moderate Additive immunosuppressive effects by the combination of Efalizumab and Abatacept. Rheumatoid arthritis [FA20] [4]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Efalizumab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [10]
Mogamulizumab DMISH0Z Moderate Additive myelosuppressive effects by the combination of Efalizumab and Mogamulizumab. Sezary syndrome [2B02] [4]
Floxuridine DM04LR2 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Floxuridine. Solid tumour/cancer [2A00-2F9Z] [4]
Dactinomycin DM2YGNW Moderate Additive myelosuppressive effects by the combination of Efalizumab and Dactinomycin. Solid tumour/cancer [2A00-2F9Z] [4]
Methylprednisolone DM4BDON Moderate Additive immunosuppressive effects by the combination of Efalizumab and Methylprednisolone. Solid tumour/cancer [2A00-2F9Z] [4]
Cyclophosphamide DM4O2Z7 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Cyclophosphamide. Solid tumour/cancer [2A00-2F9Z] [4]
Vinblastine DM5TVS3 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Vinblastine. Solid tumour/cancer [2A00-2F9Z] [4]
PDX-101 DM6OC53 Moderate Additive immunosuppressive effects by the combination of Efalizumab and PDX-101. Solid tumour/cancer [2A00-2F9Z] [4]
Ifosfamide DMCT3I8 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Ifosfamide. Solid tumour/cancer [2A00-2F9Z] [4]
Docetaxel DMDI269 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Docetaxel. Solid tumour/cancer [2A00-2F9Z] [4]
Trabectedin DMG3Y89 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [4]
Mitoxantrone DMM39BF Moderate Additive myelosuppressive effects by the combination of Efalizumab and Mitoxantrone. Solid tumour/cancer [2A00-2F9Z] [4]
LEE011 DMMX75K Moderate Additive myelosuppressive effects by the combination of Efalizumab and LEE011. Solid tumour/cancer [2A00-2F9Z] [4]
Etoposide DMNH3PG Moderate Additive immunosuppressive effects by the combination of Efalizumab and Etoposide. Solid tumour/cancer [2A00-2F9Z] [4]
Epirubicin DMPDW6T Moderate Additive myelosuppressive effects by the combination of Efalizumab and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [4]
Prednisolone DMQ8FR2 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Prednisolone. Solid tumour/cancer [2A00-2F9Z] [4]
Cisplatin DMRHGI9 Moderate Additive myelosuppressive effects by the combination of Efalizumab and Cisplatin. Solid tumour/cancer [2A00-2F9Z] [4]
Gemcitabine DMSE3I7 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Gemcitabine. Solid tumour/cancer [2A00-2F9Z] [4]
Fluorouracil DMUM7HZ Moderate Additive immunosuppressive effects by the combination of Efalizumab and Fluorouracil. Solid tumour/cancer [2A00-2F9Z] [4]
Taxol DMUOT9V Moderate Additive immunosuppressive effects by the combination of Efalizumab and Taxol. Solid tumour/cancer [2A00-2F9Z] [4]
Doxorubicin DMVP5YE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Doxorubicin. Solid tumour/cancer [2A00-2F9Z] [4]
Vinorelbine DMVXFYE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Vinorelbine. Solid tumour/cancer [2A00-2F9Z] [4]
Trimetrexate DMDEA85 Moderate Additive immunosuppressive effects by the combination of Efalizumab and Trimetrexate. Toxoplasmosis [1F57] [4]
Sirolimus DMGW1ID Moderate Additive myelosuppressive effects by the combination of Efalizumab and Sirolimus. Transplant rejection [NE84] [4]
Azathioprine DMMZSXQ Moderate Additive myelosuppressive effects by the combination of Efalizumab and Azathioprine. Transplant rejection [NE84] [4]
Mycophenolate mofetil DMPQAGE Moderate Additive immunosuppressive effects by the combination of Efalizumab and Mycophenolate mofetil. Transplant rejection [NE84] [4]
Belatacept DMXLYQF Moderate Additive immunosuppressive effects by the combination of Efalizumab and Belatacept. Transplant rejection [NE84] [4]
Tacrolimus DMZ7XNQ Moderate Additive immunosuppressive effects by the combination of Efalizumab and Tacrolimus. Transplant rejection [NE84] [4]
Durvalumab DM4PVDY Moderate Additive immunosuppressive effects by the combination of Efalizumab and Durvalumab. Ureteral cancer [2C92] [4]
Triamcinolone DM98IXF Moderate Additive immunosuppressive effects by the combination of Efalizumab and Triamcinolone. Vasomotor/allergic rhinitis [CA08] [4]
Trifluridine DMG2YBD Moderate Additive immunosuppressive effects by the combination of Efalizumab and Trifluridine. Virus infection [1A24-1D9Z] [4]
⏷ Show the Full List of 147 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6593).
2 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3 [Successful therapy of discoid lupus erythematosus with efalizumab]. Hautarzt. 2010 Mar;61(3):246-9.
4 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
5 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
6 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
7 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
8 Cerner Multum, Inc. "Australian Product Information.".
9 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
10 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]