General Information of Drug (ID: DMRJ3YX)

Drug Name
Alteplase
Synonyms Activase (TN)
Indication
Disease Entry ICD 11 Status REF
Acute myocardial infarction BA41 Approved [1]
Pulmonary embolism BB00 Approved [2]
Therapeutic Class
Thrombolytic Agents
Affected Organisms
Humans and other mammals
ATC Code
B01AD02: Alteplase
B01AD: Enzymes
B01A: ANTITHROMBOTIC AGENTS
B01: ANTITHROMBOTIC AGENTS
B: BLOOD AND BLOOD FORMING ORGANS
S01XA13: Alteplase
S01XA: Other ophthalmologicals
S01X: OTHER OPHTHALMOLOGICALS
S01: OPHTHALMOLOGICALS
S: SENSORY ORGANS
Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Cross-matching ID
UNII
1RXS4UE564
DrugBank ID
DB00009
TTD ID
D07BQE
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Plasminogen (PLG) TTP86E2 PLMN_HUMAN Activator [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Acute myocardial infarction
ICD Disease Classification BA41
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Plasminogen (PLG) DTT PLG 8.61E-01 -0.01 -0.09
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Alteplase (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Alteplase and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [4]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Alteplase and Pentosan polysulfate. Chronic pain [MG30] [5]
Phenylbutazone DMAYL0T Moderate Increased risk of bleeding by the combination of Alteplase and Phenylbutazone. Chronic pain [MG30] [6]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Alteplase and Ketoprofen. Chronic pain [MG30] [6]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Alteplase and Levomilnacipran. Chronic pain [MG30] [7]
Anisindione DM2C48U Major Increased risk of bleeding by the combination of Alteplase and Anisindione. Coagulation defect [3B10] [8]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Alteplase and Regorafenib. Colorectal cancer [2B91] [9]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Alteplase and Intedanib. Colorectal cancer [2B91] [10]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Alteplase and Ardeparin. Coronary thrombosis [BA43] [11]
Danaparoid DM6CLBN Major Increased risk of bleeding by the combination of Alteplase and Danaparoid. Deep vein thrombosis [BD71] [11]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Alteplase and Rivaroxaban. Deep vein thrombosis [BD71] [12]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Alteplase and Sertraline. Depression [6A70-6A7Z] [7]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Alteplase and Fluoxetine. Depression [6A70-6A7Z] [7]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Alteplase and Vilazodone. Depression [6A70-6A7Z] [7]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Alteplase and Paroxetine. Depression [6A70-6A7Z] [7]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Alteplase and Vortioxetine. Depression [6A70-6A7Z] [7]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Alteplase and Duloxetine. Depression [6A70-6A7Z] [7]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Alteplase and Milnacipran. Depression [6A70-6A7Z] [7]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Alteplase and Escitalopram. Depression [6A70-6A7Z] [7]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Alteplase and Desvenlafaxine. Depression [6A70-6A7Z] [7]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Alteplase and Clomipramine. Depression [6A70-6A7Z] [7]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Alteplase and Fluvoxamine. Depression [6A70-6A7Z] [7]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Alteplase and Venlafaxine. Depression [6A70-6A7Z] [7]
Heme DMGC287 Moderate Increased risk of bleeding by the combination of Alteplase and Heme. Discovery agent [N.A.] [13]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Alteplase and Apigenin. Discovery agent [N.A.] [14]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Alteplase and Citalopram derivative 1. Discovery agent [N.A.] [7]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Alteplase and PMID28870136-Compound-49. Discovery agent [N.A.] [15]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Alteplase and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [7]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Alteplase and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [6]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Alteplase and Mefenamic acid. Female pelvic pain [GA34] [6]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Alteplase and Avapritinib. Gastrointestinal stromal tumour [2B5B] [9]
Sulfinpyrazone DMEV954 Moderate Increased risk of bleeding by the combination of Alteplase and Sulfinpyrazone. Gout [FA25] [16]
Ramipril DM2R68E Moderate Increased risk of angioedema by the combination of Alteplase and Ramipril. Heart failure [BD10-BD1Z] [17]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Alteplase and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [18]
Moexipril DM26E4B Moderate Increased risk of angioedema by the combination of Alteplase and Moexipril. Hypertension [BA00-BA04] [17]
Captopril DM458UM Moderate Increased risk of angioedema by the combination of Alteplase and Captopril. Hypertension [BA00-BA04] [17]
Trandolapril DM4L6EU Moderate Increased risk of angioedema by the combination of Alteplase and Trandolapril. Hypertension [BA00-BA04] [17]
Fosinopril DM9NJ52 Moderate Increased risk of angioedema by the combination of Alteplase and Fosinopril. Hypertension [BA00-BA04] [17]
Enalapril DMNFUZR Moderate Increased risk of angioedema by the combination of Alteplase and Enalapril. Hypertension [BA00-BA04] [17]
Perindopril DMOPZDT Moderate Increased risk of angioedema by the combination of Alteplase and Perindopril. Hypertension [BA00-BA04] [17]
Quinapril DMR8H31 Moderate Increased risk of angioedema by the combination of Alteplase and Quinapril. Hypertension [BA00-BA04] [17]
Lisinopril DMUOK4C Moderate Increased risk of angioedema by the combination of Alteplase and Lisinopril. Hypertension [BA00-BA04] [17]
Dipyridamole DMXY30O Moderate Increased risk of bleeding by the combination of Alteplase and Dipyridamole. Hypertension [BA00-BA04] [16]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Alteplase and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [6]
Ticlopidine DMO946V Moderate Increased risk of bleeding by the combination of Alteplase and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [16]
Tositumomab DMMYZ3D Major Increased risk of bleeding by the combination of Alteplase and Tositumomab. Malignant haematopoietic neoplasm [2B33] [19]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Alteplase and Acalabrutinib. Mature B-cell lymphoma [2A85] [20]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Alteplase and Ibrutinib. Mature B-cell lymphoma [2A85] [21]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Alteplase and Ponatinib. Mature B-cell lymphoma [2A85] [22]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Alteplase and Panobinostat. Multiple myeloma [2A83] [17]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Alteplase and Dasatinib. Myeloproliferative neoplasm [2A20] [23]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Alteplase and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [5]
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Alteplase and Prasugrel. Myocardial infarction [BA41-BA43] [9]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Alteplase and Vorapaxar. Myocardial infarction [BA41-BA43] [24]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Alteplase and Sibutramine. Obesity [5B80-5B81] [7]
Dexfenfluramine DMJ7YDS Moderate Increased risk of bleeding by the combination of Alteplase and Dexfenfluramine. Obesity [5B80-5B81] [7]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Alteplase and Diclofenac. Osteoarthritis [FA00-FA05] [6]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Alteplase and Nepafenac. Osteoarthritis [FA00-FA05] [6]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Alteplase and Naproxen. Osteoarthritis [FA00-FA05] [6]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Alteplase and MK-4827. Ovarian cancer [2C73] [9]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Alteplase and Aspirin. Pain [MG30-MG3Z] [16]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Alteplase and Etodolac. Pain [MG30-MG3Z] [6]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Alteplase and Diflunisal. Pain [MG30-MG3Z] [16]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Alteplase and Ibuprofen. Pain [MG30-MG3Z] [6]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Alteplase and Nabumetone. Pain [MG30-MG3Z] [6]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Alteplase and Piroxicam. Pain [MG30-MG3Z] [6]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Alteplase and Choline salicylate. Postoperative inflammation [1A00-CA43] [16]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Alteplase and Ketorolac. Postoperative inflammation [1A00-CA43] [6]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Alteplase and Bromfenac. Postoperative inflammation [1A00-CA43] [6]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Alteplase and Treprostinil. Pulmonary hypertension [BB01] [16]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Alteplase and Epoprostenol. Pulmonary hypertension [BB01] [16]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Alteplase and Iloprost. Pulmonary hypertension [BB01] [16]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Alteplase and Salsalate. Rheumatoid arthritis [FA20] [16]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Alteplase and Meloxicam. Rheumatoid arthritis [FA20] [6]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Alteplase and Sulindac. Rheumatoid arthritis [FA20] [6]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Alteplase and Oxaprozin. Rheumatoid arthritis [FA20] [6]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Alteplase and Flurbiprofen. Rheumatoid arthritis [FA20] [6]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Alteplase and Fenoprofen. Rheumatoid arthritis [FA20] [6]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Alteplase and Indomethacin. Rheumatoid arthritis [FA20] [6]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Alteplase and Tolmetin. Rheumatoid arthritis [FA20] [6]
Salicyclic acid DM2F8XZ Moderate Increased risk of bleeding by the combination of Alteplase and Salicyclic acid. Seborrhoeic dermatitis [EA81] [16]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Alteplase and Curcumin. Solid tumour/cancer [2A00-2F9Z] [25]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Alteplase and Warfarin. Supraventricular tachyarrhythmia [BC81] [8]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Alteplase and Caplacizumab. Thrombocytopenia [3B64] [17]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Alteplase and Apixaban. Thrombosis [DB61-GB90] [9]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Alteplase and Cangrelor. Thrombosis [DB61-GB90] [9]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Alteplase and Brilinta. Thrombosis [DB61-GB90] [9]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Alteplase and Argatroban. Thrombosis [DB61-GB90] [26]
Dicumarol DMFQCB1 Major Increased risk of bleeding by the combination of Alteplase and Dicumarol. Thrombosis [DB61-GB90] [8]
Clopidogrel DMOL54H Moderate Increased risk of bleeding by the combination of Alteplase and Clopidogrel. Thrombosis [DB61-GB90] [16]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Alteplase and Cabozantinib. Thyroid cancer [2D10] [27]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Alteplase and Betrixaban. Venous thromboembolism [BD72] [28]
⏷ Show the Full List of 92 DDI Information of This Drug

References

1 Single-bolus tenecteplase compared with front-loaded alteplase in acute myocardial infarction: the ASSENT-2 double-blind randomised trial. Lancet. 1999 Aug 28;354(9180):716-22.
2 Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
3 Thrombolytic therapies: the current state of affairs. J Endovasc Ther. 2005 Apr;12(2):224-32.
4 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
5 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
6 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
7 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
8 Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
9 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
10 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
11 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
12 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
13 Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
14 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
15 Canadian Pharmacists Association.
16 Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
17 Cerner Multum, Inc. "Australian Product Information.".
18 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
19 Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
20 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
21 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
22 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
23 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
24 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
25 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
26 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
27 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
28 Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.