General Information of Drug Therapeutic Target (DTT) (ID: TT5TPI6)

DTT Name Opioid receptor sigma 1 (OPRS1)
Synonyms
hSigmaR1; Sigma1R; Sigma1-receptor; Sigma non-opioid intracellular receptor 1; Sigma 1-type opioid receptor; SRBP; SR31747-binding protein; SR31747 binding protein 1; SR-BP; SIG-1R; Opioid receptor, sigma 1, isoform 1; OPRS1 protein; Aging-associated gene 8 protein; AAG8
Gene Name SIGMAR1
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
SGMR1_HUMAN
TTD ID
T46360
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Function
Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration. Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria. Plays a role in protecting cells against oxidative stress-induced cell death via its interaction with RNF112. Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane.
KEGG Pathway
Amyotrophic lateral sclerosis (hsa05014 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Reactome Pathway
Potential therapeutics for SARS (R-HSA-9679191 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dextromethorphan DMUDJZM Allergic rhinitis CA08.0 Approved [1]
Dextromethorphan Polistirex DMEHCY5 Dry cough MD12 Approved [2]
------------------------------------------------------------------------------------
10 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ADX N05 DMLBYRA Mood disorder 6A60-6E23 Phase 3 [3]
AVP-786 DMV1SOR Alzheimer disease 8A20 Phase 3 [4]
CM-2395 DMASPWR Schizophrenia 6A20 Phase 3 [5]
Igmesine DMH97XA Major depressive disorder 6A70.3 Phase 2 [6]
OPC-14523 DMB1WF3 Bulimia nervosa 6B81 Phase 2 [7]
ANAVEX 2-73 DM67OU4 Alzheimer disease 8A20 Phase 1 [8]
ANAVEX 3-71 DM31634 Frontotemporal dementia 6D83 Phase 1 [9]
SA-5845 DM6XZRL Central nervous system disease 8A04-8D87 Phase 1 [10]
SSR-125047 DMSUFW6 Schizophrenia 6A20 Phase 1 [11]
SSR-125329A DMG6NI8 Immune System disease 4A01-4B41 Phase 1 [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Clinical Trial Drug(s)
27 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,2,4-triazole derivative 3 DMU9XMV N. A. N. A. Patented [13]
1,2,4-triazole derivative 4 DMHBJFN N. A. N. A. Patented [13]
Aryl alkanolamine derivative 1 DM417XY N. A. N. A. Patented [13]
Aryl alkanolamine derivative 2 DMUP0WH N. A. N. A. Patented [13]
Benzamide derivative 10 DM9PKU2 N. A. N. A. Patented [14]
Benzamide derivative 11 DM4V3Y5 N. A. N. A. Patented [14]
Benzamide derivative 7 DM7UEJT N. A. N. A. Patented [14]
Benzamide derivative 8 DMAIJHC N. A. N. A. Patented [14]
Benzamide derivative 9 DMVFSJZ N. A. N. A. Patented [14]
Isoindoline derivative 1 DMD19QC N. A. N. A. Patented [14]
Isoindoline derivative 2 DMTE0S3 N. A. N. A. Patented [14]
Isoindoline derivative 3 DM2MYL9 N. A. N. A. Patented [14]
Isoindoline derivative 4 DMP1NKI N. A. N. A. Patented [14]
Isoindoline derivative 5 DMIUTQW N. A. N. A. Patented [14]
Phenylpropylamine derivative 1 DMVCKZT N. A. N. A. Patented [13]
Phenylpropylamine derivative 2 DMTDIA6 N. A. N. A. Patented [13]
Phenylpropylamine derivative 3 DMH3FUR N. A. N. A. Patented [13]
Phenylpropylamine derivative 4 DM0R653 N. A. N. A. Patented [13]
Phenylpropylamine derivative 5 DMU0S2W N. A. N. A. Patented [13]
Piperazine derivative 7 DM9Y4ZV N. A. N. A. Patented [13]
Piperidine derivative 4 DM6C5DR N. A. N. A. Patented [13]
Piperidine derivative 5 DMQ0VK4 N. A. N. A. Patented [13]
Piperidine derivative 6 DM0GCTY N. A. N. A. Patented [13]
PMID28051882-Compound-XIV DM1RN89 N. A. N. A. Patented [13]
PMID30185082-Compound-57 DMNDF1Z N. A. N. A. Patented [14]
PMID30185082-Compound-64 DMKD470 N. A. N. A. Patented [14]
Pyrazole derivative 86 DMW3PJV N. A. N. A. Patented [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Patented Agent(s)
20 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BMS-181100 DM0HR5W Psychotic disorder 6A20-6A25 Discontinued in Phase 3 [15]
KB-5492 DM7IP8U Peptic ulcer DA61 Discontinued in Phase 2 [16]
OxycoDex DMHFOIX Pain MG30-MG3Z Discontinued in Phase 2 [4]
Panamesine DM6TPCJ Psychotic disorder 6A20-6A25 Discontinued in Phase 2 [17]
DUP-734 DMI5EPB Psychotic disorder 6A20-6A25 Discontinued in Phase 1 [18]
Gevotroline DM520D8 Psychotic disorder 6A20-6A25 Discontinued in Phase 1 [19]
AH-9700 DMXY5AV Pollakiuria MF50.1 Terminated [21]
CNS-1307 DM03LZB Schizophrenia 6A20 Terminated [4]
E-5842 DMV0QI1 Schizophrenia 6A20 Terminated [11]
E-6276 DMTEY8W Schizophrenia 6A20 Terminated [11]
FH-510 DMJ35RC Psychotic disorder 6A20-6A25 Terminated [22]
HydrocoDex DM4HA9C Pain MG30-MG3Z Terminated [4]
LU-29252 DMDHLUC Anxiety disorder 6B00-6B0Z Terminated [23]
MS-377 DMXERCA Schizophrenia 6A20 Terminated [11]
NE-033 DMEH50J Psychotic disorder 6A20-6A25 Terminated [24]
NE-100 DMP4J7T Schizophrenia 6A20 Terminated [11]
NPC-16377 DM35RTJ Psychotic disorder 6A20-6A25 Terminated [25]
PRE-084 DMDIYFH Aging skin EE40 Terminated [26]
Rimcazole DMKDS1C Schizophrenia 6A20 Terminated [11]
SR-31742A DM7ZOLE Schizophrenia 6A20 Terminated [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Discontinued Drug(s)
3 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ANAVEX 1-41 DM1MQON Alzheimer disease 8A20 Preclinical [8]
ANAVEX 1007 DM2U16Z Melanoma 2C30 Preclinical [8]
Cutamesine DMB1ET0 Major depressive disorder 6A70.3 Preclinical [20]
------------------------------------------------------------------------------------
12 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+)-SK&F10047 DM1QPA4 Discovery agent N.A. Investigative [27]
(RS)-PPCC DMA8DEG Discovery agent N.A. Investigative [28]
1,3-ditolylguanidine DM04KS1 Discovery agent N.A. Investigative [29]
2-(1H-indol-3-yl)-N,N-dimethylethanamine DMR9Q4Y Discovery agent N.A. Investigative [30]
BD-1047 DMFIDA0 Discovery agent N.A. Investigative [31]
C-10068 DMNV1ST Brain injury NA07.Z Investigative [4]
CM-156 DM7TX3D Drug abuse 6C4G.1Z Investigative [4]
CNS-1169 DMTEGNB Schizophrenia 6A20 Investigative [4]
Dimemorfan DM2Q3CL Discovery agent N.A. Investigative [32]
MC-113 DMPTNUQ Central nervous system disease 8A04-8D87 Investigative [4]
MC-116 DMQC9UB Central nervous system disease 8A04-8D87 Investigative [4]
[3H]pentazocine DMF4TWE Discovery agent N.A. Investigative [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Alzheimer's disease 8A00.0 Entorhinal cortex 2.77E-06 -0.12 -0.62
Major depressive disorder 6A20 Pre-frontal cortex 4.34E-01 0.03 0.26
Prostate cancer 2C82 Prostate 9.08E-03 0.31 0.6
Melanoma 2C82 Skin 7.53E-01 -3.56E-03 -0.01
Schizophrenia 6A20 Pre-frontal cortex 7.77E-01 -0.02 -0.07
Schizophrenia 6A20 Superior temporal cortex 1.88E-01 -0.01 -0.17
Breast cancer 2C82 Breast tissue 1.60E-20 0.27 0.63
------------------------------------------------------------------------------------
⏷ Show the Full List of DTT Expression Under 7 Diseases

References

1 Dextromethorphan/quinidine: AVP 923, dextromethorphan/cytochrome P450-2D6 inhibitor, quinidine/dextromethorphan. Drugs R D. 2005;6(3):174-7.
2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
3 Clinical pipeline report, company report or official report of SK BioPhamaceuticals.
4 Antitussives and substance abuse. Subst Abuse Rehabil. 2013 Nov 6;4:75-82.
5 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127)
6 Antiamnesic and neuroprotective effects of donepezil against learning impairments induced in mice by exposure to carbon monoxide gas. J Pharmacol Exp Ther. 2006 Jun;317(3):1307-19.
7 Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88.
8 2011 Pipeline of Anavex.
9 AF710B, an M1/sigma-1 receptor agonist with long-lasting disease-modifying properties in a transgenic rat model of Alzheimer's disease. Alzheimers Dement. 2018 Jun;14(6):811-823.
10 Tumor imaging with 2 sigma-receptor ligands, 18F-FE-SA5845 and 11C-SA4503: a feasibility study. J Nucl Med. 2004 Nov;45(11):1939-45.
11 The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
12 SSR125329A, a high affinity sigma receptor ligand with potent anti-inflammatory properties. Eur J Pharmacol. 2002 Dec 5;456(1-3):123-31.
13 Are sigma modulators an effective opportunity for cancer treatment A patent overview (1996-2016).Expert Opin Ther Pat. 2017 May;27(5):565-578.
14 The sigma-2 (-2) receptor: a review of recent patent applications: 2013-2018.Expert Opin Ther Pat. 2018 Sep;28(9):655-663.
15 BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40.
16 Sigma receptor-mediated effects of a new antiulcer agent, KB-5492, on experimental gastric mucosal lesions and gastric alkaline secretion in rats. J Pharmacol Exp Ther. 1994 May;269(2):799-805.
17 Efficacy and safety of the sigma receptor ligand EMD 57445 (panamesine) in patients with schizophrenia: an open clinical trial. Pharmacopsychiatry. 1999 Mar;32(2):68-72.
18 Piperidinyltetralin sigma ligands. J Med Chem. 1994 Feb 4;37(3):364-70.
19 Sigma receptor ligands alter concentrations of corticosterone in plasma in the rat. Neuropharmacology. 1991 Jan;30(1):79-87.
20 Effect of SA4503, a novel sigma1 receptor agonist, against glutamate neurotoxicity in cultured rat retinal neurons. Eur J Pharmacol. 1998 Jan 19;342(1):105-11.
21 Pharmacological actions of AH-9700 on micturition reflex in anesthetized rats. Eur J Pharmacol. 2001 Jan 26;412(2):171-9.
22 FH-510, a potent and selective ligand for rat brain sigma recognition sites. Eur J Pharmacol. 1993 Jul 6;238(1):89-92.
23 Involvement of sigma receptors in the modulation of the glutamatergic/NMDA neurotransmission in the dopaminergic systems. Eur J Pharmacol. 1999 Mar 5;368(2-3):183-96.
24 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004064)
25 Effects of the selective sigma receptor ligand, 6-[6-(4-hydroxypiperidinyl)hexyloxy]-3-methylflavone (NPC 16377), on behavioral and toxic effects of cocaine. J Pharmacol Exp Ther. 1993 Aug;266(2):473-82.
26 Antidepressant-like effect of PRE-084, a selective sigma1 receptor agonist, in Albino Swiss and C57BL/6J mice. Pharmacol Rep. 2009 Nov-Dec;61(6):1179-83.
27 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2552).
28 Novel sigma receptor ligands: synthesis and biological profile. J Med Chem. 2007 Mar 8;50(5):951-61.
29 Sigma1 and sigma2 receptor binding affinity and selectivity of SA4503 and fluoroethyl SA4503. Synapse. 2006 May;59(6):350-8.
30 Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97.
31 Characterization of two novel sigma receptor ligands: antidystonic effects in rats suggest sigma receptor antagonism. Eur J Pharmacol. 1995 Jul 14;280(3):301-10.
32 Dimemorfan protects rats against ischemic stroke through activation of sigma-1 receptor-mediated mechanisms by decreasing glutamate accumulation. J Neurochem. 2008 Jan;104(2):558-72.