Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQ79SU)

• DTT Name: HUMAN multidrug resistance-associated protein 1 (ABCC1)
• Synonyms: MRP1; MRP; Leukotriene C(4) transporter; LTC4 transporter; ATP-binding cassette sub-family C member 1
• Gene Name: ABCC1
• BioChemical Class: ABC transporter
• UniProt ID: MRP1_HUMAN
• TTD ID: T00926
• EC Number: EC 7.6.2.2
• Sequence:
  MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
  DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
  TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
  LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
  LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
  IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
  WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
  GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
  AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
  KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
  MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
  LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
  SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
  AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
  MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
  LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
  SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
  ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
  DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
  KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
  VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
  VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
  EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
  SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
  ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
  DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
• Function: Human protein ATP binding cassette subfamily C member 1 interacts with SARS-CoV-2 Orf9c protein with high significance, which indicates ABCC1 as a potential therapeutic target.
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  ABC transporters (hsa02010)
  Sphingolipid signaling pathway (hsa04071)
  Vitamin digestion and absorption (hsa04977)
  MicroRNAs in cancer (hsa05206)
• Reactome Pathway:
  Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691)
  ABC-family proteins mediated transport (R-HSA-382556)
  Cytoprotection by HMOX1 (R-HSA-9707564)
  Paracetamol ADME (R-HSA-9753281)
  Transport of RCbl within the body (R-HSA-9758890)
  Heme degradation (R-HSA-189483)
• BioCyc Pathway: MetaCyc:ENSG00000103222-MON

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Multidrug resistance-associated protein 1 (ABCC1) DTP Info
• Gene Name: ABCC1

38 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
99mTc-sestamibi	DMVZO01	Breast cancer	2C60-2C65	Approved	[2]
Adefovir	DMM278X	N. A.	N. A.	Approved	[3]
Cefadroxil	DMMC345	Bacterial infection	1A00-1C4Z	Approved	[4]
Chlorpheniramine	DM5URA2	Allergic rhinitis	CA08.0	Approved	[5]
Cisplatin	DMRHGI9	Adenocarcinoma	2D40	Approved	[6]
Citalopram	DM2G9AE	Acute coronary syndrome	BA41	Approved	[7]
Colchicine	DM2POTE	Acute gout flare	FA25.0	Approved	[8]
Dactinomycin	DM2YGNW	Adult kidney Wilms tumor		Approved	[9]
Daunorubicin	DMQUSBT	Acute monocytic leukemia		Approved	[10]
Dehydroepiandrosterone sulfate	DM4Q80H	N. A.	N. A.	Approved	[11]
Docetaxel	DMDI269	Advanced cancer	2A00-2F9Z	Approved	[3]
Doxorubicin	DMVP5YE	Acute myelogenous leukaemia	2A41	Approved	[12]
Epirubicin	DMPDW6T	Solid tumour/cancer	2A00-2F9Z	Approved	[13]
Estrone sulfate	DMVBIZL	Atrophic vaginitis	GA30.2	Approved	[14]
Ethacrynic acid	DM60QMR	Edema	MG29	Approved	[15]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[16]
FLUORESCEIN	DMQTFAO	Ocular disease	1F00.1Z	Approved	[17]
Flutamide	DMK0O7U	Prostate cancer	2C82.0	Approved	[18]
Folic Acid	DMEMBJC	Colorectal carcinoma		Approved	[19]
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[20]
Grepafloxacin	DMGLX0T	Chronic bronchitis	CA20.1	Approved	[21]
Idarubicin	DMM0XGL	Acute myelogenous leukaemia	2A41	Approved	[3]
Indinavir	DM0T3YH	Human immunodeficiency virus infection	1C62	Approved	[3]
Irinotecan	DMP6SC2	Adenocarcinoma	2D40	Approved	[22]
Ivermectin	DMDBX5F	Intestinal strongyloidiasis due to nematode parasite	1F6B	Approved	[23]
Lopinavir	DMITQS0	Human immunodeficiency virus infection	1C62	Approved	[24]
Methotrexate	DM2TEOL	Anterior urethra cancer		Approved	[25]
Mitoxantrone	DMM39BF	Acute myelogenous leukaemia	2A41	Approved	[26]
Paclitaxel	DMLB81S	Breast carcinoma		Approved	[3]
Phenytoin	DMNOKBV	Epilepsy	8A60-8A68	Approved	[27]
Quercetin	DM3NC4M	Obesity	5B81	Approved	[3]
Saquinavir	DMG814N	Human immunodeficiency virus infection	1C62	Approved	[28]
Saxagliptin	DMGXENV	Type-2 diabetes	5A11	Approved	[29]
Topotecan	DMP6G8T	Central nervous system neoplasm		Approved	[3]
Verapamil	DMA7PEW	Angina pectoris	BA40	Approved	[3]
Vinblastine	DM5TVS3	Advanced cancer	2A00-2F9Z	Approved	[30]
Vincristine	DMINOX3	Acute lymphoblastic leukaemia	2A85	Approved	[31]
Zoledronate	DMIXC7G	Adenocarcinoma	2D40	Approved	[32]

5 Clinical Trial Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Resveratrol	DM3RWXL	Giant cell arteritis	4A44.2	Phase 3	[3]
Glutathione-S-S-glutathione	DMJ85FS	N. A.	N. A.	Phase 2	[33]
LE-SN38	DMW50NF	Colorectal cancer	2B91.Z	Phase 2	[22]
PEITC	DMOMN31	Prostate cancer	2C82.0	Phase 2	[3]
Chlorcyclizine	DM3L52Q	Allergic rhinitis	CA08.0	Phase 1	[5]

5 Investigative Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMINOHIPPURIC ACID	DMUN54G	Discovery agent	N.A.	Investigative	[34]
Arsenite	DMBCO4Q	Discovery agent	N.A.	Investigative	[35]
Fluo-3	DMLO9FU	N. A.	N. A.	Investigative	[36]
LTE4	DMCPB0Q	Discovery agent	N.A.	Investigative	[37]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[38]

References

• [1] A SARS-CoV-2 Protein Interaction Map Reveals Targets for Drug Repurposing. Nature. 2020 Apr 30. doi: 10.1038/s41586-020-2286-9.
• [2] 99mTc-sestamibi is a substrate for P-glycoprotein and the multidrug resistance-associated protein. Br J Cancer. 1998;77(3):353-8.
• [3] Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
• [4] Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
• [5] Carrier mediated transport of chlorpheniramine and chlorcyclizine across bovine olfactory mucosa: implications on nose-to-brain transport. J Pharm Sci. 2005 Mar;94(3):613-24.
• [6] Hammerhead ribozyme against gamma-glutamylcysteine synthetase sensitizes human colonic cancer cells to cisplatin by down-regulating both the glutathione synthesis and the expression of multidrug resistance proteins. Cancer Gene Ther. 2001 Oct;8(10):803-14.
• [7] MRP1 polymorphisms associated with citalopram response in patients with major depression. J Clin Psychopharmacol. 2010 Apr;30(2):116-25.
• [8] Pharmacological characterization of the murine and human orthologs of multidrug-resistance protein in transfected human embryonic kidney cells. Mol Pharmacol. 1997 Sep;52(3):344-53.
• [9] Expression of multidrug resistance-associated protein in NIH/3T3 cells confers multidrug resistance associated with increased drug efflux and altered intracellular drug distribution. Cancer Res. 1995 Nov 15;55(22):5342-7.
• [10] Vinblastine and sulfinpyrazone export by the multidrug resistance protein MRP2 is associated with glutathione export. Br J Cancer. 2000 Aug;83(3):375-83.
• [11] Steroid and bile acid conjugates are substrates of human multidrug-resistance protein (MRP) 4 (ATP-binding cassette C4). Biochem J. 2003 Apr 15;371(Pt 2):361-7.
• [12] The role of bioreductive activation of doxorubicin in cytotoxic activity against leukaemia HL60-sensitive cell line and its multidrug-resistant sublines. Br J Cancer. 2005 Jul 11;93(1):89-97.
• [13] Sulindac sulfide selectively increases sensitivity of ABCC1 expressing tumor cells to doxorubicin and glutathione depletion. J Biomed Res. 2016 Mar;30(2):120-133.
• [14] Molecular cloning and pharmacological characterization of rat multidrug resistance protein 1 (mrp1). Drug Metab Dispos. 2003 Aug;31(8):1016-26.
• [15] Inhibition of the multidrug resistance protein 1 (MRP1) by peptidomimetic glutathione-conjugate analogs. Mol Pharmacol. 2002 Nov;62(5):1160-6.
• [16] Multidrug resistance-associated protein-1 functional activity in Calu-3 cells. J Pharmacol Exp Ther. 2001 Sep;298(3):1199-205.
• [17] Transport of fluorescein in MDCKII-MRP1 transfected cells and mrp1-knockout mice. Biochem Biophys Res Commun. 2001 Jun 22;284(4):863-9.
• [18] The multidrug resistance-associated protein 1 transports methoxychlor and protects the seminiferous epithelium from injury. Toxicol Lett. 2003 Apr 30;142(1-2):61-70.
• [19] Folate concentration dependent transport activity of the Multidrug Resistance Protein 1 (ABCC1). Biochem Pharmacol. 2004 Apr 15;67(8):1541-8.
• [20] Structural determinants of substrate specificity differences between human multidrug resistance protein (MRP) 1 (ABCC1) and MRP3 (ABCC3). Drug Metab Dispos. 2008 Dec;36(12):2571-81.
• [21] Limited distribution of new quinolone antibacterial agents into brain caused by multiple efflux transporters at the blood-brain barrier. J Pharmacol Exp Ther. 2000 Oct;295(1):146-52.
• [22] ATP-Dependent efflux of CPT-11 and SN-38 by the multidrug resistance protein (MRP) and its inhibition by PAK-104P. Mol Pharmacol. 1999 May;55(5):921-8.
• [23] Interaction of ivermectin with multidrug resistance proteins (MRP1, 2 and 3). Chem Biol Interact. 2006 Feb 25;159(3):169-79.
• [24] Inhibition of P-glycoprotein and multidrug resistance-associated proteins modulates the intracellular concentration of lopinavir in cultured CD4 T cells and primary human lymphocytes. J Antimicrob Chemother. 2007 Nov;60(5):987-93.
• [25] Transport of methotrexate (MTX) and folates by multidrug resistance protein (MRP) 3 and MRP1: effect of polyglutamylation on MTX transport. Cancer Res. 2001 Oct 1;61(19):7225-32.
• [26] Multidrug resistance protein 1 (MRP1, ABCC1) mediates resistance to mitoxantrone via glutathione-dependent drug efflux. Mol Pharmacol. 2006 Apr;69(4):1499-505.
• [27] Evaluation of transport of common antiepileptic drugs by human multidrug resistance-associated proteins (MRP1, 2 and 5) that are overexpressed in pharmacoresistant epilepsy. Neuropharmacology. 2010 Jun;58(7):1019-32.
• [28] Direct evidence that saquinavir is transported by multidrug resistance-associated protein (MRP1) and canalicular multispecific organic anion transporter (MRP2). Antimicrob Agents Chemother. 2002 Nov;46(11):3456-62.
• [29] Dipeptidylpeptidase-4 inhibitors (gliptins): focus on drug-drug interactions. Clin Pharmacokinet. 2010 Sep;49(9):573-88.
• [30] Development and characterization of a recombinant Madin-Darby canine kidney cell line that expresses rat multidrug resistance-associated protein 1 (rMRP1). AAPS PharmSci. 2004 Mar 9;6(1):E8.
• [31] Interaction of plant cannabinoids with the multidrug transporter ABCC1 (MRP1). Eur J Pharmacol. 2008 Sep 4;591(1-3):128-31.
• [32] Zoledronic acid is synergic with vinblastine to induce apoptosis in a multidrug resistance protein-1 dependent way: an in vitro study. Cell Biol Int. 2006 Mar;30(3):278-82.
• [33] Anthracyclines modulate multidrug resistance protein (MRP) mediated organic anion transport. Biochim Biophys Acta. 1997 May 22;1326(1):12-22.
• [34] ATP-dependent para-aminohippurate transport by apical multidrug resistance protein MRP2. Kidney Int. 2000 Apr;57(4):1636-42.
• [35] Comparative Molecular Docking Studies with ABCC1 and Aquaporin 9 in the Arsenite Complex Efflux. Bioinformation. 2014 Aug 30;10(8):474-9.
• [36] Export pumps for anionic conjugates encoded by MRP genes. Adv Enzyme Regul. 1999;39:237-46.
• [37] Transport of glutathione, glucuronate, and sulfate conjugates by the MRP gene-encoded conjugate export pump. Cancer Res. 1996 Mar 1;56(5):988-94.
• [38] Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells. Mol Pharmacol. 1999 May;55(5):929-37.