Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE37ABY)

DME Name Phosphodiesterase 5A (PDE5A)
Synonyms Phosphodiesterase class 5A; cGMP-binding cGMP-specific phosphodiesterase; cGMP-specific 3',5'-cyclic phosphodiesterase; CGB-PDE; PDE5; PDE5A
Gene Name PDE5A
UniProt ID
PDE5A_HUMAN
INTEDE ID
DME0195
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
8654
EC Number EC: 3.1.4.35
Hydrolases
Ester bond hydrolase
Phosphoric diester hydrolase
EC: 3.1.4.35
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Function This enzyme catalyzes the specific hydrolysis of cGMP to 5'-GMP.
KEGG Pathway
Metabolic pathways (hsa01100 )
Purine metabolism (hsa00230 )
cGMP-PKG signaling pathway (hsa04022 )
Reactome Pathway
cGMP effects (R-HSA-418457 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Molsidomine DM9MA8O Angina pectoris BA40 Approved [33]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.00E-29 -1.93E-01 -1.42E+00
Alopecia ED70 Skin from scalp 2.27E-02 -1.13E-01 -7.83E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.98E-01 9.55E-03 5.64E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.67E-01 2.52E-02 3.03E-01
Aortic stenosis BB70 Calcified aortic valve 9.45E-01 -7.70E-03 -1.24E-02
Apnea 7A40 Hyperplastic tonsil 9.77E-01 -9.53E-02 -1.20E+00
Arthropathy FA00-FA5Z Peripheral blood 2.28E-01 1.25E-03 1.12E-02
Asthma CA23 Nasal and bronchial airway 3.24E-05 -7.04E-02 -1.69E-01
Atopic dermatitis EA80 Skin 5.18E-03 6.73E-02 7.39E-01
Autism 6A02 Whole blood 5.18E-01 4.27E-02 2.69E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.14E-01 -2.12E-02 -2.38E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.50E-01 7.50E-02 4.80E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.58E-02 4.71E-02 2.31E-01
Batten disease 5C56.1 Whole blood 6.72E-01 1.71E-01 4.59E-01
Behcet's disease 4A62 Peripheral blood 5.85E-01 7.55E-02 4.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.44E-01 2.50E-02 2.19E-01
Bladder cancer 2C94 Bladder tissue 8.86E-02 -5.69E-01 -7.38E-01
Breast cancer 2C60-2C6Z Breast tissue 9.41E-20 -2.85E-01 -6.87E-01
Cardioembolic stroke 8B11.20 Whole blood 1.15E-03 1.86E-01 8.07E-01
Cervical cancer 2C77 Cervical tissue 1.04E-01 -5.30E-02 -3.47E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.21E-03 1.48E-01 6.88E-01
Chronic hepatitis C 1E51.1 Whole blood 5.31E-01 6.40E-02 3.27E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.18E-01 3.07E-02 8.13E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.48E-02 -2.97E-02 -3.10E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.90E-01 9.02E-03 6.63E-02
Colon cancer 2B90 Colon tissue 4.36E-24 -4.20E-01 -1.10E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.72E-01 -4.22E-02 -1.36E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.22E-01 1.55E-02 1.45E-01
Endometriosis GA10 Endometrium tissue 1.96E-01 -1.23E-01 -1.97E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.94E-01 -2.32E-02 -3.83E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.07E-01 1.19E-01 4.94E-01
Gastric cancer 2B72 Gastric tissue 9.98E-01 2.09E-01 2.46E-01
Glioblastopma 2A00.00 Nervous tissue 2.82E-08 2.08E-02 1.03E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.36E-01 8.92E-02 2.16E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.87E-03 -2.59E-01 -1.09E+00
Head and neck cancer 2D42 Head and neck tissue 4.03E-03 6.34E-02 3.88E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.04E-01 -1.29E-02 -6.50E-02
Huntington's disease 8A01.10 Whole blood 5.60E-01 8.30E-03 7.55E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.85E-01 3.09E-01 1.11E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.68E-01 -4.00E-04 -1.12E-02
Influenza 1E30 Whole blood 4.86E-01 1.41E-02 1.85E-01
Interstitial cystitis GC00.3 Bladder tissue 2.23E-01 -8.04E-02 -3.29E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.66E-02 -4.66E-01 -9.34E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.49E-02 -4.74E-02 -2.34E-01
Ischemic stroke 8B11 Peripheral blood 2.61E-01 1.16E-01 6.41E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.80E-11 2.80E-01 1.05E+00
Lateral sclerosis 8B60.4 Skin 6.86E-01 -1.17E-02 -7.25E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.75E-01 6.00E-02 5.36E-01
Liver cancer 2C12.0 Liver tissue 8.93E-01 -1.00E-03 -6.28E-03
Liver failure DB99.7-DB99.8 Liver tissue 8.97E-01 -3.90E-02 -3.16E-01
Lung cancer 2C25 Lung tissue 2.32E-29 -8.03E-01 -1.24E+00
Lupus erythematosus 4A40 Whole blood 2.56E-01 8.19E-03 3.14E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.07E-01 1.62E-02 1.55E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.01E-01 1.88E-02 9.42E-02
Melanoma 2C30 Skin 8.60E-02 -9.03E-02 -1.78E-01
Multiple myeloma 2A83.1 Peripheral blood 4.30E-01 1.16E-01 1.86E+00
Multiple myeloma 2A83.1 Bone marrow 3.23E-02 -2.51E-01 -1.29E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.48E-01 -1.29E-01 -4.84E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.43E-01 -7.98E-03 -9.31E-02
Myelofibrosis 2A20.2 Whole blood 8.07E-01 1.60E-02 1.83E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.09E-01 1.55E-01 4.10E-01
Myopathy 8C70.6 Muscle tissue 1.89E-02 2.60E-01 9.29E-01
Neonatal sepsis KA60 Whole blood 1.03E-03 9.01E-02 5.89E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.24E-01 -3.12E-01 -1.52E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.64E-01 -1.16E-01 -1.21E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.45E-01 2.29E-02 1.73E-01
Olive pollen allergy CA08.00 Peripheral blood 2.44E-01 -1.00E-01 -7.18E-01
Oral cancer 2B6E Oral tissue 1.20E-03 -1.80E-01 -9.25E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.74E-01 4.09E-01 1.26E+00
Osteoporosis FB83.1 Bone marrow 8.92E-01 1.43E-01 2.66E-01
Ovarian cancer 2C73 Ovarian tissue 3.47E-02 -2.90E-01 -6.90E-01
Pancreatic cancer 2C10 Pancreas 1.85E-01 -8.21E-02 -3.40E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.09E-01 3.20E-02 3.11E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.04E-01 3.33E-02 1.97E-01
Pituitary cancer 2D12 Pituitary tissue 1.14E-02 1.14E-01 6.45E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.55E-03 1.95E-01 2.27E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.03E-01 4.93E-02 4.63E-01
Polycythemia vera 2A20.4 Whole blood 6.41E-01 3.21E-03 3.20E-02
Pompe disease 5C51.3 Biceps muscle 2.12E-02 -2.17E-01 -1.46E+00
Preterm birth KA21.4Z Myometrium 6.44E-01 3.81E-02 1.68E-01
Prostate cancer 2C82 Prostate 9.91E-01 -1.08E-01 -2.45E-01
Psoriasis EA90 Skin 3.23E-05 -2.17E-01 -6.06E-01
Rectal cancer 2B92 Rectal colon tissue 1.60E-01 -2.48E-01 -9.94E-01
Renal cancer 2C90-2C91 Kidney 8.65E-01 -6.16E-02 -1.81E-01
Retinoblastoma 2D02.2 Uvea 5.76E-03 -2.48E-01 -1.87E+00
Rheumatoid arthritis FA20 Synovial tissue 3.27E-02 3.80E-01 1.36E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.75E-02 2.40E-02 3.16E-01
Schizophrenia 6A20 Prefrontal cortex 3.56E-01 1.13E-02 6.64E-02
Schizophrenia 6A20 Superior temporal cortex 8.10E-01 -2.79E-02 -3.05E-01
Scleroderma 4A42.Z Whole blood 1.32E-01 8.13E-02 8.38E-01
Seizure 8A60-8A6Z Whole blood 1.16E-02 -1.01E-01 -5.93E-01
Sensitive skin EK0Z Skin 7.63E-01 -6.54E-02 -3.79E-01
Sepsis with septic shock 1G41 Whole blood 4.41E-03 3.39E-02 2.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.95E-01 -5.87E-02 -2.40E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.92E-02 2.73E-01 8.91E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.93E-01 -2.45E-02 -1.98E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.90E-01 6.33E-02 6.22E-01
Skin cancer 2C30-2C3Z Skin 7.74E-18 -2.42E-01 -6.50E-01
Thrombocythemia 3B63 Whole blood 2.17E-01 -6.34E-02 -7.58E-01
Thrombocytopenia 3B64 Whole blood 1.49E-01 3.63E-02 4.07E-01
Thyroid cancer 2D10 Thyroid 1.35E-33 1.04E+00 3.02E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.32E-02 2.57E-01 9.25E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.47E-01 1.98E-02 8.71E-02
Type 2 diabetes 5A11 Liver tissue 9.29E-01 5.29E-03 7.04E-02
Ureter cancer 2C92 Urothelium 6.65E-01 -5.89E-02 -6.93E-01
Uterine cancer 2C78 Endometrium tissue 5.82E-02 -1.31E-01 -3.52E-01
Vitiligo ED63.0 Skin 9.67E-01 -1.17E-01 -4.22E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Phosphodiesterase 5A (PDE5A) DTT Info
DME DTT Type Successful
7 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Avanafil DM75CXN Erectile dysfunction HA01.1 Approved [1]
Dipyridamole DMXY30O Atrial fibrillation BC81.3 Approved [2]
Papaverine DMCA9QP Brain ischaemia 8B1Z Approved [3]
Rhucin DM3ADGP Erectile dysfunction HA01.1 Approved [4]
Tadalafil DMJZHT1 Benign prostatic hyperplasia GA90 Approved [5]
Udenafil DM1IQRP Erectile dysfunction HA01.1 Approved [6]
Vardenafil DMTBGW8 Cystic fibrosis CA25 Approved [7]
⏷ Show the Full List of 7 Approved Drug(s)
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
EXISULIND DMBY56U Colorectal cancer 2B91.Z Phase 3 [8]
ICARIIN DMOJQGT N. A. N. A. Phase 3 [9]
PF-489791 DM3C8GQ Chronic obstructive pulmonary disease CA22 Phase 2 [10]
UK-371800 DMI8795 Erectile dysfunction HA01.1 Phase 1 [11]
12 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRL-61063 DMV3Y8R Allergy 4A80-4A85 Discontinued in Phase 2 [12]
DASANTAFIL DMOWIGC Erectile dysfunction HA01.1 Discontinued in Phase 2 [1]
E-4021 DMWIA56 Cardiovascular disease BA00-BE2Z Discontinued in Phase 2 [13]
EMR-62203 DMIQRJW Erectile dysfunction HA01.1 Discontinued in Phase 2 [14]
SINITRODIL DMMZ2JT Angina pectoris BA40 Discontinued in Phase 2 [1]
SLX-2101 DM1J0YB Erectile dysfunction HA01.1 Discontinued in Phase 2 [15]
UK-369003 DMHXRZF Erectile dysfunction HA01.1 Discontinued in Phase 1/2 [16]
FR-229934 DMT6R8I Erectile dysfunction HA01.1 Terminated [17]
IMAZODAN DMWTFO3 N. A. N. A. Terminated [18]
SKF-96231 DMS2M58 Asthma CA23 Terminated [19]
Trequinsin DMQRSMD N. A. N. A. Terminated [20]
ZAPRINAST DMGH3T5 N. A. N. A. Terminated [21]
⏷ Show the Full List of 12 Discontinued Drug(s)
23 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
3,7-Bis(2-hydroxyethyl)icaritin DMQADXL Discovery agent N.A. Investigative [9]
7-(2-Hydroxyethyl)-3-O-rhamnosylicariin DMBIY98 Discovery agent N.A. Investigative [9]
8-prenylapigenin DM2VC0E Discovery agent N.A. Investigative [9]
8-prenylquercetin DMZC1SV Discovery agent N.A. Investigative [9]
Aom-0890 DMT4I2W Erectile dysfunction HA01.1 Investigative [22]
Benzo[1,3]dioxol-5-ylmethyl-quinazolin-4-yl-amine DM067NL Discovery agent N.A. Investigative [23]
Cartazolate DMSKT8G Discovery agent N.A. Investigative [24]
CKD-533 DMH204Y Erectile dysfunction HA01.1 Investigative [22]
Gamma-Glutamyl[S-(2-Iodobenzyl)Cysteinyl]Glycine DMHNJDE Discovery agent N.A. Investigative [25]
Guanosine-5'-Monophosphate DM3SLZK Discovery agent N.A. Investigative [25]
Icariside II DM3DB8X Discovery agent N.A. Investigative [9]
isobutylmethylxanthine DM46F5X Discovery agent N.A. Investigative [26]
KURAIDIN DMLDUJ1 Discovery agent N.A. Investigative [27]
KURARINOL DMRV5YE Discovery agent N.A. Investigative [27]
LORNEIC ACID A DM0ECUK Discovery agent N.A. Investigative [28]
ROLIPRAM DMJ03UM Discovery agent N.A. Investigative [23]
RWJ-387273 DM28IKN Discovery agent N.A. Investigative [29]
SCH-57726 DMDK8TR Discovery agent N.A. Investigative [30]
SCH51866 DMCWSJP Discovery agent N.A. Investigative [31]
SOPHOFLAVESCENOL DM8Y1S7 Discovery agent N.A. Investigative [27]
SOPHORAFLAVANONE B DMUVKX5 Discovery agent N.A. Investigative [9]
T0156 DMZE9TW Discovery agent N.A. Investigative [32]
TPN-729 DMW9G7H Erectile dysfunction HA01.1 Investigative [22]
⏷ Show the Full List of 23 Investigative Drug(s)

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
2 Anti-platelet therapy: phosphodiesterase inhibitors.Br J Clin Pharmacol.2011 Oct;72(4):634-46.
3 Effects of icariin on cGMP-specific PDE5 and cAMP-specific PDE4 activities. Asian J Androl. 2003 Mar;5(1):15-8.
4 cGMP-hydrolytic activity and its inhibition by sildenafil in normal and failing human and mouse myocardium. J Pharmacol Exp Ther. 2009 Sep;330(3):884-91.
5 Pulmonary arterial hypertension: the most devastating vascular complication of systemic sclerosis. Rheumatology (Oxford). 2009 Jun;48 Suppl 3:iii25-31.
6 Increased expression of the nitric oxide synthase gene and protein in corpus cavernosum by repeated dosing of udenafil in a rat model of chemical d... Asian J Androl. 2009 Jul;11(4):435-42.
7 The effect of vardenafil, a potent and highly selective phosphodiesterase-5 inhibitor for the treatment of erectile dysfunction, on the cardiovascular response to exercise in patients with coronary artery disease. J Am Coll Cardiol. 2002 Dec 4;40(11):2006-12.
8 Exisulind induction of apoptosis involves guanosine 3',5'-cyclic monophosphate phosphodiesterase inhibition, protein kinase G activation, and attenuated beta-catenin. Cancer Res. 2000 Jul 1;60(13):3338-42.
9 Potent inhibition of human phosphodiesterase-5 by icariin derivatives. J Nat Prod. 2008 Sep;71(9):1513-7.
10 Highlights of the society for medicinesresearch symposium held december 10th 2009 at the national heart and lung institute, London, UK. Drugs of the Future 2010, 35(4): 349-358.
11 Highly potent and selective chiral inhibitors of PDE5: an illustration of Pfeiffer's rule. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6033-6.
12 Inhibition of cyclic nucleotide phosphodiesterase by derivatives of 1,3-bis(cyclopropylmethyl)xanthine. J Med Chem. 1994 Feb 18;37(4):476-85.
13 Potency and mechanism of action of E4021, a type 5 phosphodiesterase isozyme-selective inhibitor, on the photoreceptor phosphodiesterase depend on the state of activation of the enzyme. Mol Pharmacol. 1999 Mar;55(3):508-14.
14 WO patent application no. 2006,0180,88, Use of a pde 5 inhibitor for treating and preventing hypopigmentary disorders.
15 Novel phosphodiesterase-5 (PDE5) inhibitors in the alleviation of erectile dysfunction due to diabetes and ageing-induced oxidative stress. Expert Opin Investig Drugs. 2008 Jun;17(6):855-64.
16 Pfizer. Product Development Pipeline. March 31 2009.
17 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014897)
18 Cardiotonic agents. 1. 4,5-Dihydro-6-[4-(1H-imidazol-1-yl)phenyl]-3 (2H)-pyridazinones: novel positive inotropic agents for the treatment of conges... J Med Chem. 1984 Sep;27(9):1099-101.
19 Analogue-based Drug Discovery II. Janos Fischer,C. Robin Ganellin. Page(150).
20 Inhibition of cyclic adenosine-3',5'-monophosphate phosphodiesterase from vascular smooth muscle by rolipram analogues. J Med Chem. 1989 Jul;32(7):1450-7.
21 4-(3-Chloro-4-methoxybenzyl)aminophthalazines: synthesis and inhibitory activity toward phosphodiesterase 5. J Med Chem. 2000 Jun 29;43(13):2523-9.
22 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1304).
23 Cyclic GMP phosphodiesterase inhibitors. 2. Requirement of 6-substitution of quinazoline derivatives for potent and selective inhibitory activity. J Med Chem. 1994 Jun 24;37(13):2106-11.
24 Substituted pyrazolopyridines as potent and selective PDE5 inhibitors: potential agents for treatment of erectile dysfunction. J Med Chem. 2001 Mar 29;44(7):1025-7.
25 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
26 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
27 A prenylated flavonol, sophoflavescenol: a potent and selective inhibitor of cGMP phosphodiesterase 5. Bioorg Med Chem Lett. 2002 Sep 2;12(17):2313-6.
28 Lorneic acids, trialkyl-substituted aromatic acids from a marine-derived actinomycete. J Nat Prod. 2009 Nov;72(11):2046-8.
29 DOI: 10.1021/op060099f
30 The Gif system as a tool in medicinal chemistry: The oxidation of Sch 57726 under GoAggIII conditions, Bioorg. Med. Chem. Lett. 7(11):1381-1386 (1997).
31 Antiplatelet and antiproliferative effects of SCH 51866, a novel type 1 and type 5 phosphodiesterase inhibitor. J Cardiovasc Pharmacol. 1996 Dec;28(6):862-9.
32 Enzymological and pharmacological profile of T-0156, a potent and selective phosphodiesterase type 5 inhibitor. Eur J Pharmacol. 2002 Dec 5;456(1-3):91-8.
33 DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (id: DB09282)