Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT01JHHE)

DOT Name Stonin-2 (STON2)
Synonyms Stoned B
Gene Name STON2
Related Disease
Alcohol dependence ( )
Epithelial ovarian cancer ( )
Metastatic malignant neoplasm ( )
Thyroid gland papillary carcinoma ( )
Schizophrenia ( )
UniProt ID
STON2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2JXC
Pfam ID
PF00928 ; PF12016
Sequence
MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGS
QDHSHSEQDDSSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQE
TAETALPLTMPCWTCPSFDSLGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQT
SGQASGADSTDNSSSLQEDEEVEMEAISWQASSPAMNGHPAPPVTSARFPSWVTFDDNEV
SCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPKSTLMNFSKVQKLDISSLNRT
PSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLI
VIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSA
RSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICH
EISEPRLQNYDENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLS
FIHAVQDRLMDLPVLSMDLSTVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIH
ILSFLSGLAECRLGLNDILVKGNEIVLRQDIMPTTTTKWIKLHECRFHGCVDEDVFHNSR
VILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAEVEVQSWLRMSTGFSANRDPL
TQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSGSEPVMRVTLG
TAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTT
SASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAML
TMFAW
Function Adapter protein involved in endocytic machinery. Involved in the synaptic vesicle recycling. May facilitate clathrin-coated vesicle uncoating.
Tissue Specificity Ubiquitous.
Reactome Pathway
Clathrin-mediated endocytosis (R-HSA-8856828 )
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alcohol dependence DIS4ZSCO Strong Biomarker [1]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [2]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [3]
Thyroid gland papillary carcinoma DIS48YMM Strong Biomarker [3]
Schizophrenia DISSRV2N moderate Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
16 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Stonin-2 (STON2). [5]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Stonin-2 (STON2). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Stonin-2 (STON2). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Stonin-2 (STON2). [8]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Stonin-2 (STON2). [9]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol affects the expression of Stonin-2 (STON2). [10]
Trifluoperazine DMKBYWI Approved Trifluoperazine decreases the expression of Stonin-2 (STON2). [11]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Stonin-2 (STON2). [12]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Stonin-2 (STON2). [14]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Stonin-2 (STON2). [15]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Stonin-2 (STON2). [16]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Stonin-2 (STON2). [17]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Stonin-2 (STON2). [18]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Stonin-2 (STON2). [19]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Stonin-2 (STON2). [8]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Stonin-2 (STON2). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Stonin-2 (STON2). [13]
------------------------------------------------------------------------------------

References

1 Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.J Mol Neurosci. 2012 Feb;46(2):265-71. doi: 10.1007/s12031-011-9530-6. Epub 2011 May 6.
2 Stonin 2 Overexpression is Correlated with Unfavorable Prognosis and Tumor Invasion in Epithelial Ovarian Cancer.Int J Mol Sci. 2017 Jul 29;18(8):1653. doi: 10.3390/ijms18081653.
3 miR-199b-5p-Stonin 2 axis regulates metastases and epithelial-to-mesenchymal transition of papillary thyroid carcinoma.IUBMB Life. 2019 Jan;71(1):28-40. doi: 10.1002/iub.1889. Epub 2018 Oct 16.
4 Cortical surface area correlates with STON2 gene Ser307Pro polymorphism in first-episode treatment-nave patients with schizophrenia.PLoS One. 2013 Jun 13;8(6):e64090. doi: 10.1371/journal.pone.0064090. Print 2013.
5 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
6 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
10 The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
11 Stonin 2 activates lysosomal-mTOR axis for cell survival in oral cancer. Toxicol In Vitro. 2023 Apr;88:105561. doi: 10.1016/j.tiv.2023.105561. Epub 2023 Jan 23.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
17 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
18 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
19 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
20 Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.