Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT01SO0E)

DOT Name Histone deacetylase complex subunit SAP130 (SAP130)
Synonyms 130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130
Gene Name SAP130
Related Disease
Colorectal carcinoma ( )
Crohn disease ( )
Hypoplastic left heart syndrome ( )
High blood pressure ( )
Hypoplastic left heart syndrome 1 ( )
UniProt ID
SP130_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16014
Sequence
MGPPRHPQAGEIEAGGAGGGRRLQVEMSSQQFPRLGAPSTGLSQAPSQIANSGSAGLINP
AATVNDESGRDSEVSAREHMSSSSSLQSREEKQEPVVVRPYPQVQMLSTHHAVASATPVA
VTAPPAHLTPAVPLSFSEGLMKPPPKPTMPSRPIAPAPPSTLSLPPKVPGQVTVTMESSI
PQASAIPVATISGQQGHPSNLHHIMTTNVQMSIIRSNAPGPPLHIGASHLPRGAAAAAVM
SSSKVTTVLRPTSQLPNAATAQPAVQHIIHQPIQSRPPVTTSNAIPPAVVATVSATRAQS
PVITTTAAHATDSALSRPTLSIQHPPSAAISIQRPAQSRDVTTRITLPSHPALGTPKQQL
HTMAQKTIFSTGTPVAAATVAPILATNTIPSATTAGSVSHTQAPTSTIVTMTVPSHSSHA
TAVTTSNIPVAKVVPQQITHTSPRIQPDYPAERSSLIPISGHRASPNPVAMETRSDNRPS
VPVQFQYFLPTYPPSAYPLAAHTYTPITSSVSTIRQYPVSAQAPNSAITAQTGVGVASTV
HLNPMQLMTVDASHARHIQGIQPAPISTQGIQPAPIGTPGIQPAPLGTQGIHSATPINTQ
GLQPAPMGTQQPQPEGKTSAVVLADGATIVANPISNPFSAAPAATTVVQTHSQSASTNAP
AQGSSPRPSILRKKPATDGAKPKSEIHVSMATPVTVSMETVSNQNNDQPTIAVPPTAQQP
PPTIPTMIAAASPPSQPAVALSTIPGAVPITPPITTIAAAPPPSVTVGGSLSSVLGPPVP
EIKVKEEVEPMDIMRPVSAVPPLATNTVSPSLALLANNLSMPTSDLPPGASPRKKPRKQQ
HVISTEEGDMMETNSTDDEKSTAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLL
RHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTN
LEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVL
DHKDRVLKLLNKNGTVKKVSKLKRKEKV
Function
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.
Tissue Specificity Expressed in various cancer cell ines.
Reactome Pathway
NoRC negatively regulates rRNA expression (R-HSA-427413 )
HATs acetylate histones (R-HSA-3214847 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colorectal carcinoma DIS5PYL0 Definitive Altered Expression [1]
Crohn disease DIS2C5Q8 Strong Biomarker [2]
Hypoplastic left heart syndrome DISSLFZ4 Strong Biomarker [3]
High blood pressure DISY2OHH moderate Biomarker [4]
Hypoplastic left heart syndrome 1 DISW3OY8 Limited Genetic Variation [5]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Histone deacetylase complex subunit SAP130 (SAP130). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Histone deacetylase complex subunit SAP130 (SAP130). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Histone deacetylase complex subunit SAP130 (SAP130). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Histone deacetylase complex subunit SAP130 (SAP130). [9]
Marinol DM70IK5 Approved Marinol increases the expression of Histone deacetylase complex subunit SAP130 (SAP130). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Histone deacetylase complex subunit SAP130 (SAP130). [11]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Histone deacetylase complex subunit SAP130 (SAP130). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Histone deacetylase complex subunit SAP130 (SAP130). [12]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Histone deacetylase complex subunit SAP130 (SAP130). [13]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Histone deacetylase complex subunit SAP130 (SAP130). [14]
------------------------------------------------------------------------------------

References

1 SAP155-mediated splicing of FUSE-binding protein-interacting repressor serves as a molecular switch for c-myc gene expression.Mol Cancer Res. 2012 Jun;10(6):787-99. doi: 10.1158/1541-7786.MCR-11-0462. Epub 2012 Apr 11.
2 Preliminary exploration of the potential of spliceosome-associated protein 130 for predicting disease severity in Crohn's disease.Ann N Y Acad Sci. 2020 Feb;1462(1):128-138. doi: 10.1111/nyas.14240. Epub 2019 Oct 3.
3 The complex genetics of hypoplastic left heart syndrome.Nat Genet. 2017 Jul;49(7):1152-1159. doi: 10.1038/ng.3870. Epub 2017 May 22.
4 Western diet in the perinatal period promotes dysautonomia in the offspring of adult rats.J Dev Orig Health Dis. 2017 Apr;8(2):216-225. doi: 10.1017/S2040174416000623. Epub 2016 Dec 9.
5 The Genetic Landscape of Hypoplastic Left Heart Syndrome.Pediatr Cardiol. 2018 Aug;39(6):1069-1081. doi: 10.1007/s00246-018-1861-4. Epub 2018 Mar 22.
6 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
7 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
10 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.