Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT02LDQN)

• DOT Name: CAMPATH-1 antigen (CD52)
• Synonyms: CDw52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; Human epididymis-specific protein 5; He5; CD antigen CD52
• Gene Name: CD52
• UniProt ID: CD52_HUMAN
• PDB ID: 6OBD
• Pfam ID: PF15116
• Sequence:
  MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
  S
• Function: May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CAMPATH-1 antigen (CD52).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CAMPATH-1 antigen (CD52).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of CAMPATH-1 antigen (CD52).	[13]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of CAMPATH-1 antigen (CD52).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CAMPATH-1 antigen (CD52).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of CAMPATH-1 antigen (CD52).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of CAMPATH-1 antigen (CD52).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of CAMPATH-1 antigen (CD52).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of CAMPATH-1 antigen (CD52).	[4]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of CAMPATH-1 antigen (CD52).	[7]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of CAMPATH-1 antigen (CD52).	[8]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of CAMPATH-1 antigen (CD52).	[9]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of CAMPATH-1 antigen (CD52).	[10]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of CAMPATH-1 antigen (CD52).	[12]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [3] Arsenic trioxide-induced apoptosis and differentiation are associated respectively with mitochondrial transmembrane potential collapse and retinoic acid signaling pathways in acute promyelocytic leukemia. Leukemia. 2000 Feb;14(2):262-70. doi: 10.1038/sj.leu.2401650.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [6] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [7] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [9] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [10] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [13] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.