Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0GR2F6)

DOT Name Disks large-associated protein 3 (DLGAP3)
Synonyms DAP-3; PSD-95/SAP90-binding protein 3; SAP90/PSD-95-associated protein 3; SAPAP3
Gene Name DLGAP3
Related Disease
Gastric cancer ( )
Obsessive compulsive disorder ( )
Osteochondritis dissecans ( )
Schizophrenia ( )
Stomach cancer ( )
Tourette syndrome ( )
Parkinson disease ( )
Anxiety ( )
Anxiety disorder ( )
Glioblastoma multiforme ( )
UniProt ID
DLGP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03359
Sequence
MRGYHGDRGSHPRPARFADQQHMDVGPAARAPYLLGSREAFSTEPRFCAPRAGLGHISPE
GPLSLSEGPSVGPEGGPAGAGVGGGSSTFPRMYPGQGPFDTCEDCVGHPQGKGAPRLPPT
LLDQFEKQLPVQQDGFHTLPYQRGPAGAGPGPAPGTGTAPEPRSESPSRIRHLVHSVQKL
FAKSHSLEAPGKRDYNGPKAEGRGGSGGDSYPGPGSGGPHTSHHHHHHHHHHHHQSRHGK
RSKSKDRKGDGRHQAKSTGWWSSDDNLDSDSGFLAGGRPPGEPGGPFCLEGPDGSYRDLS
FKGRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMVSQGRDGYPGAGPGKGLLGPETKA
KARTYHYLQVPQDDWGGYPTGGKDGEIPCRRMRSGSYIKAMGDEESGDSDGSPKTSPKAV
ARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFG
ELESQAVDALDLPGCFRMRSHSYLRAIQAGCSQDDDCLPLLATPAAVSGRPGSSFNFRKA
PPPIPPGSQAPPRISITAQSSTDSAHESFTAAEGPARRCSSADGLDGPAMGARTLELAPV
PPRASPKPPTLIIKTIPGREELRSLARQRKWRPSIGVQVETISDSDTENRSRREFHSIGV
QVEEDKRRARFKRSNSVTAGVQADLELEGLAGLATVATEDKALQFGRSFQRHASEPQPGP
RAPTYSVFRTVHTQGQWAYREGYPLPYEPPATDGSPGPAPAPTPGPGAGRRDSWIERGSR
SLPDSGRASPCPRDGEWFIKMLRAEVEKLEHWCQQMEREAEDYELPEEILEKIRSAVGST
QLLLSQKVQQFFRLCQQSMDPTAFPVPTFQDLAGFWDLLQLSIEDVTLKFLELQQLKANS
WKLLEPKEEKKVPPPIPKKPLRGRGVPVKERSLDSVDRQRQEARKRLLAAKRAASFRHSS
ATESADSIEIYIPEAQTRL
Function
May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.
Reactome Pathway
Neurexins and neuroligins (R-HSA-6794361 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Gastric cancer DISXGOUK Strong Biomarker [1]
Obsessive compulsive disorder DIS1ZMM2 Strong Genetic Variation [2]
Osteochondritis dissecans DIS1FGN4 Strong Biomarker [3]
Schizophrenia DISSRV2N Strong Biomarker [4]
Stomach cancer DISKIJSX Strong Biomarker [1]
Tourette syndrome DISX9D54 Strong Biomarker [5]
Parkinson disease DISQVHKL Disputed Biomarker [6]
Anxiety DISIJDBA Limited Biomarker [7]
Anxiety disorder DISBI2BT Limited Biomarker [7]
Glioblastoma multiforme DISK8246 Limited Altered Expression [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Disks large-associated protein 3 (DLGAP3). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Disks large-associated protein 3 (DLGAP3). [10]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Disks large-associated protein 3 (DLGAP3). [11]
------------------------------------------------------------------------------------

References

1 Examination of the expression and prognostic significance of DLGAPs in gastric cancer using the TCGA database and bioinformatic analysis.Mol Med Rep. 2018 Dec;18(6):5621-5629. doi: 10.3892/mmr.2018.9574. Epub 2018 Oct 23.
2 Lateral orbitofrontal dysfunction in the Sapap3 knockout mouse model of obsessivecompulsive disorder.J Psychiatry Neurosci. 2019 Mar 1;44(2):120-131. doi: 10.1503/jpn.180032.
3 Sapap3 and pathological grooming in humans: Results from the OCD collaborative genetics study.Am J Med Genet B Neuropsychiatr Genet. 2009 Jul 5;150B(5):710-20. doi: 10.1002/ajmg.b.30897.
4 Exonic resequencing of the DLGAP3 gene as a candidate gene for schizophrenia.Psychiatry Res. 2013 Jun 30;208(1):84-7. doi: 10.1016/j.psychres.2012.12.015. Epub 2013 Feb 13.
5 Family-based genetic association study of DLGAP3 in Tourette Syndrome.Am J Med Genet B Neuropsychiatr Genet. 2011 Jan;156B(1):108-14. doi: 10.1002/ajmg.b.31134. Epub 2010 Nov 2.
6 Gene expression profiling predicts pathways and genes associated with Parkinson's disease.Neurol Sci. 2016 Jan;37(1):73-79. doi: 10.1007/s10072-015-2360-5. Epub 2015 Aug 13.
7 Behavioral flexibility in a mouse model for obsessive-compulsive disorder: Impaired Pavlovian reversal learning in SAPAP3 mutants.Genes Brain Behav. 2019 Apr;18(4):e12557. doi: 10.1111/gbb.12557. Epub 2019 Feb 27.
8 Death-associated protein 3 (Dap-3) is overexpressed in invasive glioblastoma cells in vivo and in glioma cell lines with induced motility phenotype in vitro.Clin Cancer Res. 2001 Aug;7(8):2480-9.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
11 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.