Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1IXGBX)

• DOT Name: Pregnancy-specific beta-1-glycoprotein 7 (PSG7)
• Synonyms: PS-beta-G-7; PSBG-7; Pregnancy-specific glycoprotein 7
• Gene Name: PSG7
• Related Disease:
  Type-1 diabetes
  Frontotemporal dementia
  Mitochondrial disease
  Parkinsonian disorder
  Prostate cancer
  Prostate carcinoma
  Helicoid peripapillary chorioretinal degeneration
  Neoplasm
• UniProt ID: PSG7_HUMAN
• Pfam ID: PF13895 ; PF13927 ; PF07686
• Sequence:
  MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
  NLTGYIWYKGQIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSY
  TLHIIKRGDGTGGVTGRFTFTLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLW
  WMNGQSLPMTHSLQLSETNRTLYLFGVTNYTAGPYECEIRNPVSASRSDPVTLNLLPKLP
  KPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSLPVSPRVKRRIENRILILPSV
  TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNP
  PAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[1]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[2]
Mitochondrial disease	DISKAHA3	Strong	Biomarker	[3]
Parkinsonian disorder	DISHGY45	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[4]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[4]
Helicoid peripapillary chorioretinal degeneration	DISFSS5N	Limited	Altered Expression	[5]
Neoplasm	DISZKGEW	Limited	Biomarker	[6]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Pregnancy-specific beta-1-glycoprotein 7 (PSG7).	[7]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Pregnancy-specific beta-1-glycoprotein 7 (PSG7).	[8]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Pregnancy-specific beta-1-glycoprotein 7 (PSG7).	[9]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Pregnancy-specific beta-1-glycoprotein 7 (PSG7).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 7 (PSG7).	[10]

References

• [1] Effects of a Ganoderma atrum polysaccharide against pancreatic damage in streptozotocin-induced diabetic mice.Food Funct. 2019 Nov 1;10(11):7227-7238. doi: 10.1039/c9fo01990a. Epub 2019 Oct 16.
• [2] Tau gene mutation in familial progressive subcortical gliosis.Nat Med. 1999 Apr;5(4):454-7. doi: 10.1038/7454.
• [3] Ganoderma atrum polysaccharide improves doxorubicin-induced cardiotoxicity in mice by regulation of apoptotic pathway in mitochondria.Carbohydr Polym. 2018 Dec 15;202:581-590. doi: 10.1016/j.carbpol.2018.08.144. Epub 2018 Sep 3.
• [4] Predictive value of the UICC and AJCC 8th edition tumor-nodes-metastasis (TNM) classification for patients treated with radical prostatectomy.Cancer Epidemiol. 2018 Oct;56:126-132. doi: 10.1016/j.canep.2018.08.007. Epub 2018 Aug 31.
• [5] Evaluation of the protective effects of Ganoderma atrum polysaccharide on acrylamide-induced injury in small intestine tissue of rats.Food Funct. 2019 Sep 1;10(9):5863-5872. doi: 10.1039/c9fo01452g. Epub 2019 Aug 29.
• [6] Toll-like receptor 4 mediates the antitumor host response induced by Ganoderma atrum polysaccharide.J Agric Food Chem. 2015 Jan 21;63(2):517-25. doi: 10.1021/jf5041096. Epub 2015 Jan 9.
• [7] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [8] 2,3,7,8-tetrachlorodibenzo-p-dioxin augments the modulation of gene expression mediated by the thyroid hormone receptor. Toxicol Appl Pharmacol. 2004 Feb 1;194(3):201-10. doi: 10.1016/j.taap.2003.09.010.
• [9] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.