Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1VCC2M)

• DOT Name: LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2)
• Gene Name: LYSMD2
• UniProt ID: LYSM2_HUMAN
• Pfam ID: PF01476
• Sequence:
  MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
  PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
  KPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFL
  QRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[9]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[14]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[12]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of LysM and putative peptidoglycan-binding domain-containing protein 2 (LYSMD2).	[13]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [14] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.