Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4BSR7D)

DOT Name	CMRF35-like molecule 6 (CD300C)
Synonyms	CLM-6; CD300 antigen-like family member C; CMRF35-A1; CMRF-35; Immunoglobulin superfamily member 16; IgSF16; CD antigen CD300c
Gene Name	CD300C
Related Disease	Cytomegalovirus infection ( ) Autoimmune disease ( ) Graft-versus-host disease ( ) Non-insulin dependent diabetes ( ) Cardiomyopathy ( ) Hepatocellular carcinoma ( )
UniProt ID	CLM6_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07686
Sequence	MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPP QILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFS NVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ
Tissue Specificity	Present on the surface of monocytes, neutrophils, a proportion of peripheral blood T- and B-lymphocytes and lymphocytic cell lines.
Reactome Pathway	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cytomegalovirus infection	DISCEMGC	Strong	Genetic Variation	[1]
Autoimmune disease	DISORMTM	moderate	Biomarker	[2]
Graft-versus-host disease	DIS0QADF	moderate	Biomarker	[2]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[3]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[4]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CMRF35-like molecule 6 (CD300C).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of CMRF35-like molecule 6 (CD300C).	[9]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CMRF35-like molecule 6 (CD300C).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of CMRF35-like molecule 6 (CD300C).	[8]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of CMRF35-like molecule 6 (CD300C).	[7]
------------------------------------------------------------------------------------

References

1	Asymptomatic CMV infections in long-term renal transplant recipients are associated with the loss of FcR from LIR-1(+) NK cells.Eur J Immunol. 2016 Nov;46(11):2597-2608. doi: 10.1002/eji.201646422. Epub 2016 Sep 26.
2	A CD300c-Fc Fusion Protein Inhibits T Cell Immunity.Front Immunol. 2018 Nov 15;9:2657. doi: 10.3389/fimmu.2018.02657. eCollection 2018.
3	Deficiency of mitophagy receptor FUNDC1 impairs mitochondrial quality and aggravates dietary-induced obesity and metabolic syndrome.Autophagy. 2019 Nov;15(11):1882-1898. doi: 10.1080/15548627.2019.1596482. Epub 2019 Apr 6.
4	Therapeutic Effects of Liraglutide, Oxytocin and Granulocyte Colony-Stimulating Factor in Doxorubicin-Induced Cardiomyopathy Model: An Experimental Animal Study.Cardiovasc Toxicol. 2019 Dec;19(6):510-517. doi: 10.1007/s12012-019-09524-x.
5	The HGF-MET axis coordinates liver cancer metabolism and autophagy for chemotherapeutic resistance.Autophagy. 2019 Jul;15(7):1258-1279. doi: 10.1080/15548627.2019.1580105. Epub 2019 Feb 20.
6	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
8	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
9	Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.