Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4IZR4R)

• DOT Name: c-Myc-binding protein (MYCBP)
• Synonyms: Associate of Myc 1; AMY-1
• Gene Name: MYCBP
• UniProt ID: MYCBP_HUMAN
• PDB ID: 2YY0
• Sequence:
  MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
  EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
• Function: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
• Tissue Specificity: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	c-Myc-binding protein (MYCBP) affects the response to substance of Doxorubicin.	[16]
Vinblastine	DM5TVS3	Approved	c-Myc-binding protein (MYCBP) affects the response to substance of Vinblastine.	[16]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of c-Myc-binding protein (MYCBP).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of c-Myc-binding protein (MYCBP).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of c-Myc-binding protein (MYCBP).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of c-Myc-binding protein (MYCBP).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of c-Myc-binding protein (MYCBP).	[5]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of c-Myc-binding protein (MYCBP).	[6]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of c-Myc-binding protein (MYCBP).	[7]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of c-Myc-binding protein (MYCBP).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of c-Myc-binding protein (MYCBP).	[9]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of c-Myc-binding protein (MYCBP).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of c-Myc-binding protein (MYCBP).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of c-Myc-binding protein (MYCBP).	[13]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of c-Myc-binding protein (MYCBP).	[14]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of c-Myc-binding protein (MYCBP).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of c-Myc-binding protein (MYCBP).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Transforming growth factor beta1 targets estrogen receptor signaling in bronchial epithelial cells. Respir Res. 2018 Aug 30;19(1):160. doi: 10.1186/s12931-018-0861-5.
• [6] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [7] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [8] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [12] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [14] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [15] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [16] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.