Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4LO2GJ)

• DOT Name: Pancreatic progenitor cell differentiation and proliferation factor (PPDPF)
• Synonyms: Exocrine differentiation and proliferation factor
• Gene Name: PPDPF
• Related Disease:
  Colon cancer
  Colon carcinoma
  Hepatocellular carcinoma
  Non-small-cell lung cancer
• UniProt ID: PPDPF_HUMAN
• Pfam ID: PF15060
• Sequence:
  MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFF
  GKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS
• Function: Probable regulator of exocrine pancreas development.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Strong	Biomarker	[1]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[11]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[8]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[8]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[9]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[10]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Pancreatic progenitor cell differentiation and proliferation factor (PPDPF).	[13]

References

• [1] Circular RNA circ-FOXM1 facilitates cell progression as ceRNA to target PPDPF and MACC1 by sponging miR-1304-5p in non-small cell lung cancer.Biochem Biophys Res Commun. 2019 May 21;513(1):207-212. doi: 10.1016/j.bbrc.2019.03.213. Epub 2019 Apr 4.
• [2] Pancreatic progenitor cell differentiation and proliferation factor predicts poor prognosis in heptaocellular carcinoma.Medicine (Baltimore). 2019 Mar;98(9):e14552. doi: 10.1097/MD.0000000000014552.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [8] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [9] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [10] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [13] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.