Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT53E50E)

• DOT Name: G antigen 1 (GAGE1)
• Synonyms: GAGE-1; Antigen MZ2-F; Cancer/testis antigen 4.1; CT4.1
• Gene Name: GAGE1
• Related Disease:
  Adenocarcinoma
  Hepatocellular carcinoma
  Lung cancer
  Melorheostosis
  Neoplasm
  Non-small-cell lung cancer
  Pancreatic tumour
  Small-cell lung cancer
  Urinary bladder neoplasm
  Epstein barr virus infection
  Head-neck squamous cell carcinoma
  Melanoma
  Thyroid gland papillary carcinoma
• UniProt ID: GAGE1_HUMAN
• Pfam ID: PF05831
• Sequence:
  MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
  DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC
• Function: Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.
• Tissue Specificity: Expressed in a variety of tumor tissues but not in normal tissues, except testis.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[2]
Lung cancer	DISCM4YA	Strong	Altered Expression	[3]
Melorheostosis	DISIMCL3	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[5]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[6]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[1]
Small-cell lung cancer	DISK3LZD	Strong	Altered Expression	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[3]
Epstein barr virus infection	DISOO0WT	moderate	Altered Expression	[5]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[8]
Melanoma	DIS1RRCY	moderate	Biomarker	[9]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[10]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Aripiprazole	DM3NUMH	Approved	Aripiprazole increases the expression of G antigen 1 (GAGE1).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of G antigen 1 (GAGE1).	[12]

References

• [1] Expression of cancer testis antigens in pancreatic carcinoma cell lines, pancreatic adenocarcinoma and chronic pancreatitis.Int J Cancer. 2004 Apr 20;109(4):568-75. doi: 10.1002/ijc.20006.
• [2] Different gene expression of MDM2, GAGE-1, -2 and FHIT in hepatocellular carcinoma and focal nodular hyperplasia.Br J Cancer. 1999 Apr;80(1-2):73-8. doi: 10.1038/sj.bjc.6690324.
• [3] A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.J Exp Med. 1995 Sep 1;182(3):689-98. doi: 10.1084/jem.182.3.689.
• [4] A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening.Proc Natl Acad Sci U S A. 1997 Mar 4;94(5):1914-8. doi: 10.1073/pnas.94.5.1914.
• [5] Relationship between GAGE-1/-2 expression, EBV infection and interferon-gamma expression in undifferentiated carcinoma of nasopharyngeal type.Anticancer Res. 2000 May-Jun;20(3A):1727-32.
• [6] Upregulated circular RNA circ_0016760 indicates unfavorable prognosis in NSCLC and promotes cell progression through miR-1287/GAGE1 axis.Biochem Biophys Res Commun. 2018 Sep 10;503(3):2089-2094. doi: 10.1016/j.bbrc.2018.07.164. Epub 2018 Aug 6.
• [7] IFN-gamma gene transfer restores HLA-class I expression and MAGE-3 antigen presentation to CTL in HLA-deficient small cell lung cancer.Gene Ther. 1997 Oct;4(10):1029-35. doi: 10.1038/sj.gt.3300489.
• [8] Expression and Prognostic Relevance of GAGE1 and XAGE1 Cancer/Testis Antigens in Head and Neck Squamous Cell Carcinoma.Curr Mol Med. 2017;17(10):707-717. doi: 10.2174/1566524018666180322162145.
• [9] Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.Cancer Res. 1999 Jul 1;59(13):3157-65.
• [10] MAGE-1, GAGE-1/-2 gene expression in FNAB of classic variant of papillary thyroid carcinoma and papillary hyperplasia in nodular goiter.Int J Mol Med. 1999 Oct;4(4):445-8. doi: 10.3892/ijmm.4.4.445.
• [11] Small Molecule Antipsychotic Aripiprazole Potentiates Ozone-Induced Inflammation in Airway Epithelium. Chem Res Toxicol. 2019 Oct 21;32(10):1997-2005. doi: 10.1021/acs.chemrestox.9b00149. Epub 2019 Sep 11.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.