Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT650E98)

DOT Name Anoctamin-2 (ANO2)
Synonyms Transmembrane protein 16B
Gene Name ANO2
Related Disease
Nervous system disease ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Inflammation ( )
Multiple sclerosis ( )
Neoplasm ( )
Panic disorder ( )
Von willebrand disease ( )
Von Willebrand disease 3 ( )
UniProt ID
ANO2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16178 ; PF04547
Sequence
MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPC
GGESTRSSSVINNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPG
HSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENK
SQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMYEIKAGGSIAKKFSAALQKLSSHLQPR
VPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHEILKRTACSRANNTMGI
NSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKI
GLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEE
RAQEHSRPEYETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFA
SILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIY
GAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVF
DGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEAGETD
SAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRL
DAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYW
FILSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKL
MDEPALRSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHTNV
Function
Calcium-activated chloride channel (CaCC) which may play a role in olfactory signal transduction. Odorant molecules bind to odor-sensing receptors (OSRs), leading to an increase in calcium entry that activates CaCC current which amplifies the depolarization of the OSR cells, ANO2 seems to be the underlying chloride channel involved in this process. May mediate light perception amplification in retina.
Tissue Specificity Retina, especially in the photoreceptor synaptic terminals.
KEGG Pathway
Olfactory transduction (hsa04740 )
Reactome Pathway
Olfactory Signaling Pathway (R-HSA-381753 )
Induction of Cell-Cell Fusion (R-HSA-9733458 )
Stimuli-sensing channels (R-HSA-2672351 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nervous system disease DISJ7GGT Definitive Biomarker [1]
Endometrial cancer DISW0LMR Strong Biomarker [2]
Endometrial carcinoma DISXR5CY Strong Biomarker [2]
Inflammation DISJUQ5T Strong Altered Expression [3]
Multiple sclerosis DISB2WZI Strong Biomarker [3]
Neoplasm DISZKGEW Strong Biomarker [4]
Panic disorder DISD3VNY Strong Biomarker [5]
Von willebrand disease DIS3TZCH Strong Genetic Variation [6]
Von Willebrand disease 3 DISPVXSD Strong Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Anoctamin-2 (ANO2). [7]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Anoctamin-2 (ANO2). [8]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Anoctamin-2 (ANO2). [9]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Anoctamin-2 (ANO2). [10]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Anoctamin-2 (ANO2). [13]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Anoctamin-2 (ANO2). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Anoctamin-2 (ANO2). [12]
------------------------------------------------------------------------------------

References

1 Autoantibodies in Pandemrix()-induced narcolepsy: Nine candidate autoantigens fail the conformational autoantibody test.Autoimmunity. 2019 Jun;52(4):185-191. doi: 10.1080/08916934.2019.1643843. Epub 2019 Jul 22.
2 Estrogen receptor alpha activates MAPK signaling pathway to promote the development of endometrial cancer.J Cell Biochem. 2019 Oct;120(10):17593-17601. doi: 10.1002/jcb.29027. Epub 2019 May 29.
3 Molecular mimicry between Anoctamin 2 and Epstein-Barr virus nuclear antigen 1 associates with multiple sclerosis risk.Proc Natl Acad Sci U S A. 2019 Aug 20;116(34):16955-16960. doi: 10.1073/pnas.1902623116. Epub 2019 Aug 2.
4 Multifunctional anti-angiogenic activity of the cyclic peroxide ANO-2 with antitumor activity.Int J Cancer. 2002 Jul 10;100(2):220-7. doi: 10.1002/ijc.10469.
5 A survey of putative anxiety-associated genes in panic disorder patients with and without bladder symptoms.Psychiatr Genet. 2012 Dec;22(6):271-8. doi: 10.1097/YPG.0b013e3283586248.
6 A common 253-kb deletion involving VWF and TMEM16B in German and Italian patients with severe von Willebrand disease type 3.J Thromb Haemost. 2007 Apr;5(4):722-8. doi: 10.1111/j.1538-7836.2007.02460.x. Epub 2007 Feb 26.
7 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
8 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
9 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
10 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
13 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.