Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6FTW9Z)

• DOT Name: SPRY domain-containing protein 7 (SPRYD7)
• Synonyms: Chronic lymphocytic leukemia deletion region gene 6 protein; CLL deletion region gene 6 protein
• Gene Name: SPRYD7
• Related Disease:
  Neoplasm
  Small lymphocytic lymphoma
• UniProt ID: SPRY7_HUMAN
• PDB ID: 7CCB
• Pfam ID: PF00622
• Sequence:
  MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
  HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPA
  NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
  TPPPGFEKILFEQQIF

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[2]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of SPRY domain-containing protein 7 (SPRYD7).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of SPRY domain-containing protein 7 (SPRYD7).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[9]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[10]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of SPRY domain-containing protein 7 (SPRYD7).	[11]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of SPRY domain-containing protein 7 (SPRYD7).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of SPRY domain-containing protein 7 (SPRYD7).	[13]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of SPRY domain-containing protein 7 (SPRYD7).	[14]

References

• [1] Gene expression and single nucleotide polymorphism array analyses of spindle cell lipomas and conventional lipomas with 13q14 deletion.Genes Chromosomes Cancer. 2011 Aug;50(8):619-32. doi: 10.1002/gcc.20884. Epub 2011 May 11.
• [2] RFP2, c13ORF1, and FAM10A4 are the most likely tumor suppressor gene candidates for B-cell chronic lymphocytic leukemia.Cancer Genet Cytogenet. 2003 Oct 1;146(1):48-57. doi: 10.1016/s0165-4608(03)00126-2.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [13] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.