Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6J6LY3)

• DOT Name: BEN domain-containing protein 5 (BEND5)
• Gene Name: BEND5
• Related Disease:
  Advanced cancer
  Colorectal carcinoma
  Endometriosis
• UniProt ID: BEND5_HUMAN
• Pfam ID: PF10523
• Sequence:
  MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGAGPESPPRAPRD
  WGALLLHKAQILALAEDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIK
  RPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPR
  ALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQD
  VLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVH
  LGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPL
  SPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNL
  Q
• Function: Acts as a transcriptional repressor.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[1]
Endometriosis	DISX1AG8	moderate	Genetic Variation	[2]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of BEN domain-containing protein 5 (BEND5).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of BEN domain-containing protein 5 (BEND5).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of BEN domain-containing protein 5 (BEND5).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of BEN domain-containing protein 5 (BEND5).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of BEN domain-containing protein 5 (BEND5).	[6]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of BEN domain-containing protein 5 (BEND5).	[7]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of BEN domain-containing protein 5 (BEND5).	[8]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of BEN domain-containing protein 5 (BEND5).	[4]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of BEN domain-containing protein 5 (BEND5).	[4]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of BEN domain-containing protein 5 (BEND5).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of BEN domain-containing protein 5 (BEND5).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of BEN domain-containing protein 5 (BEND5).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of BEN domain-containing protein 5 (BEND5).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of BEN domain-containing protein 5 (BEND5).	[10]

References

• [1] Hypermethylation of BEND5 contributes to cell proliferation and is a prognostic marker of colorectal cancer.Oncotarget. 2017 Nov 1;8(69):113431-113443. doi: 10.18632/oncotarget.22266. eCollection 2017 Dec 26.
• [2] New variants near RHOJ and C2, HLA-DRA region and susceptibility to endometriosis in the Polish population-The genome-wide association study.Eur J Obstet Gynecol Reprod Biol. 2017 Oct;217:106-112. doi: 10.1016/j.ejogrb.2017.08.037. Epub 2017 Sep 1.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [5] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [8] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.