Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6NAJJI)

DOT Name	Submaxillary gland androgen-regulated protein 3A (SMR3A)
Synonyms	Proline-rich protein 5; Proline-rich protein PBI
Gene Name	SMR3A
Related Disease	Anxiety ( ) Bloom syndrome ( ) Burkitt lymphoma ( ) Depression ( ) Head-neck squamous cell carcinoma ( ) Neoplasm ( ) Oropharyngeal squamous cell carcinoma ( ) Skin disease ( ) Rheumatoid arthritis ( ) Anxiety disorder ( ) Erectile dysfunction ( ) Invasive ductal breast carcinoma ( )
UniProt ID	SMR3A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15621
Sequence	MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGP GRFPPPLSPPYGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFP VNSPTDPALPTPAP
Function	May play a role in protection or detoxification.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Anxiety	DISIJDBA	Strong	Genetic Variation	[1]
Bloom syndrome	DISKXQ7J	Strong	Genetic Variation	[2]
Burkitt lymphoma	DIS9D5XU	Strong	Genetic Variation	[2]
Depression	DIS3XJ69	Strong	Genetic Variation	[1]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[3]
Oropharyngeal squamous cell carcinoma	DIS7D7QV	Strong	Altered Expression	[3]
Skin disease	DISDW8R6	Strong	Biomarker	[4]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[5]
Anxiety disorder	DISBI2BT	Limited	Genetic Variation	[6]
Erectile dysfunction	DISD8MTH	Limited	Biomarker	[7]
Invasive ductal breast carcinoma	DIS43J58	Limited	Genetic Variation	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Submaxillary gland androgen-regulated protein 3A (SMR3A).	[9]
------------------------------------------------------------------------------------

References

1	Dynamic Pruritus Score: Evaluation of the Validity and Reliability of a New Instrument to Assess the Course of Pruritus.Acta Derm Venereol. 2017 Feb 8;97(2):230-234. doi: 10.2340/00015555-2494.
2	Percutaneous interventional management of biliary complications after pediatric liver transplantation: A 16-year single-institution experience.Pediatr Transplant. 2017 Feb;21(1). doi: 10.1111/petr.12837. Epub 2016 Oct 30.
3	Regulation of submaxillary gland androgen-regulated protein 3A via estrogen receptor 2 in radioresistant head and neck squamous cell carcinoma cells.J Exp Clin Cancer Res. 2017 Feb 6;36(1):25. doi: 10.1186/s13046-017-0496-2.
4	Measuring Patient Needs and Benefits in Dermatology using the Patient Benefit Index 2.0: A Validation Study.Acta Derm Venereol. 2019 Feb 1;99(2):211-217. doi: 10.2340/00015555-3063.
5	Cross-Sectional Evaluation of Periodontal Status and Microbiologic and Rheumatoid Parameters in a Large Cohort of Patients With Rheumatoid Arthritis.J Periodontol. 2017 Apr;88(4):368-379. doi: 10.1902/jop.2016.160355. Epub 2016 Nov 18.
6	Perceived maternal care is associated with emotional eating in young adults.Physiol Behav. 2019 Mar 15;201:91-94. doi: 10.1016/j.physbeh.2018.12.022. Epub 2018 Dec 20.
7	hSMR3A as a marker for patients with erectile dysfunction.J Urol. 2007 Jul;178(1):338-43. doi: 10.1016/j.juro.2007.03.004. Epub 2007 May 23.
8	The Role of Partial Breast Radiation in the Previously Radiated Breast.Am J Clin Oncol. 2019 Dec;42(12):932-936. doi: 10.1097/COC.0000000000000584.
9	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.