Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7336MZ)

DOT Name	Trimeric intracellular cation channel type A (TMEM38A)
Synonyms	TRIC-A; TRICA; Transmembrane protein 38A
Gene Name	TMEM38A
Related Disease	Essential hypertension ( ) High blood pressure ( )
UniProt ID	TM38A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF05197
Sequence	MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPIASWLCAML HCFGSYILADLLLGEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHHYHHGWFVMIATGWVKGSGVALMSNFEQLLRGVWKPETNEI LHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFIFTLFMVSCKVFLTATHSHSSPFDAL EGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD
Function	Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Essential hypertension	DIS7WI98	Strong	Biomarker	[1]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[2]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[3]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Trimeric intracellular cation channel type A (TMEM38A).	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	TRIC-A channels in vascular smooth muscle contribute to blood pressure maintenance.Cell Metab. 2011 Aug 3;14(2):231-41. doi: 10.1016/j.cmet.2011.05.011.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
4	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
5	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
6	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
7	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.