Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7DR5T2)

DOT Name HORMA domain-containing protein 1 (HORMAD1)
Synonyms Cancer/testis antigen 46; CT46; Newborn ovary HORMA protein
Gene Name HORMAD1
Related Disease
Azoospermia ( )
Gastric cancer ( )
Lung adenocarcinoma ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Obesity ( )
Oligospermia ( )
Stomach cancer ( )
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
Advanced cancer ( )
Epithelial ovarian cancer ( )
Neoplasm ( )
UniProt ID
HORM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8J69
Pfam ID
PF02301
Sequence
MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDD
LCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFK
YTNNGPLMDFISKNQSNESSMLSTDTKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYY
DEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMENIDSTI
LSPKQIKTPFQKILRDKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDE
IMRSKESPDLSISHSQVEQLVNKTSELDMSESKTRSGKVFQNKMANGNQPVKSSKENRKR
SQHESGRIVLHHFDSSSQESVPKRRKFSEPKEHI
Function
Plays a key role in meiotic progression. Regulates 3 different functions during meiosis: ensures that sufficient numbers of processed DNA double-strand breaks (DSBs) are available for successful homology search by increasing the steady-state numbers of single-stranded DSB ends. Promotes synaptonemal-complex formation independently of its role in homology search. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes.
Tissue Specificity Testis-specific. Over-expressed in carcinomas.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Azoospermia DIS94181 Strong Genetic Variation [1]
Gastric cancer DISXGOUK Strong Altered Expression [2]
Lung adenocarcinoma DISD51WR Strong Altered Expression [3]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [4]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [3]
Obesity DIS47Y1K Strong Biomarker [4]
Oligospermia DIS6YJF3 Strong Biomarker [5]
Stomach cancer DISKIJSX Strong Altered Expression [2]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation DIS56JR8 Moderate Autosomal recessive [6]
Advanced cancer DISAT1Z9 Limited Biomarker [3]
Epithelial ovarian cancer DIS56MH2 Limited Altered Expression [7]
Neoplasm DISZKGEW Limited Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of HORMA domain-containing protein 1 (HORMAD1). [8]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of HORMA domain-containing protein 1 (HORMAD1). [9]
Decitabine DMQL8XJ Approved Decitabine affects the expression of HORMA domain-containing protein 1 (HORMAD1). [9]
------------------------------------------------------------------------------------

References

1 Single-nucleotide polymorphisms in HORMAD1 may be a risk factor for azoospermia caused by meiotic arrest in Japanese patients.Asian J Androl. 2012 Jul;14(4):580-3. doi: 10.1038/aja.2011.180. Epub 2012 Mar 12.
2 Systematic search for gastric cancer-specific genes based on SAGE data: melanoma inhibitory activity and matrix metalloproteinase-10 are novel prognostic factors in patients with gastric cancer.Oncogene. 2006 Apr 20;25(17):2546-57. doi: 10.1038/sj.onc.1209279.
3 HORMAD1 Is a Negative Prognostic Indicator in Lung Adenocarcinoma and Specifies Resistance to Oxidative and Genotoxic Stress.Cancer Res. 2018 Nov 1;78(21):6196-6208. doi: 10.1158/0008-5472.CAN-18-1377. Epub 2018 Sep 5.
4 Physical Interactions and Expression Quantitative Traits Loci Identify Regulatory Connections for Obesity and Type 2 Diabetes Associated SNPs.Front Genet. 2017 Oct 13;8:150. doi: 10.3389/fgene.2017.00150. eCollection 2017.
5 Causes and Clinical Features of Infertile Men With Nonobstructive Azoospermia and Histopathologic Diagnosis of Hypospermatogenesis.Urology. 2017 Jul;105:62-68. doi: 10.1016/j.urology.2017.03.026. Epub 2017 Mar 22.
6 A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
7 Biological significance of HORMA domain containing protein 1 (HORMAD1) in epithelial ovarian carcinoma.Cancer Lett. 2013 Apr 28;330(2):123-9. doi: 10.1016/j.canlet.2012.07.001. Epub 2012 Jul 7.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.