Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7SQGM8)

• DOT Name: P antigen family member 1 (PAGE1)
• Synonyms: PAGE-1; AL5; G antigen 9; GAGE-9; G antigen family B member 1; Prostate-associated gene 1 protein
• Gene Name: PAGE1
• Related Disease:
  Adult germ cell tumor
  Advanced cancer
  Germ cell tumor
  Germ cell tumour
  Non-insulin dependent diabetes
  Prostate cancer
  Prostate carcinoma
• UniProt ID: PAGE1_HUMAN
• Pfam ID: PF05831
• Sequence:
  MGFLRRLIYRRRPMIYVESSEESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQGQEPE
  ADSQELVQPKTGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDG
  PDVQELGLPNPEEVKTPEEDEGQSQP
• Tissue Specificity: Isolated from prostate cancer cell lines; expression associated with progression to androgen insensitive phenotype. Expressed in normal testis and at lower level in normal placenta.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult germ cell tumor	DISJUCQ7	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Germ cell tumor	DIS62070	Strong	Biomarker	[1]
Germ cell tumour	DISOF3TK	Strong	Biomarker	[1]
Non-insulin dependent diabetes	DISK1O5Z	Disputed	Biomarker	[2]
Prostate cancer	DISF190Y	Limited	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of P antigen family member 1 (PAGE1).	[4]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of P antigen family member 1 (PAGE1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of P antigen family member 1 (PAGE1).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of P antigen family member 1 (PAGE1).	[7]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of P antigen family member 1 (PAGE1).	[8]

References

• [1] PAGE-1, an X chromosome-linked GAGE-like gene that is expressed in normal and neoplastic prostate, testis, and uterus.Proc Natl Acad Sci U S A. 1998 Sep 1;95(18):10757-62. doi: 10.1073/pnas.95.18.10757.
• [2] Improvement of quality of life through glycemic control by liraglutide, a GLP-1 analog, in insulin-naive patients with type 2 diabetes mellitus: the PAGE1 study.Diabetol Metab Syndr. 2017 Jan 7;9:3. doi: 10.1186/s13098-016-0202-0. eCollection 2017.
• [3] Prostate stem cell antigen is a promising candidate for immunotherapy of advanced prostate cancer.Cancer Res. 2000 Oct 1;60(19):5522-8.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [6] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [8] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.