Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8BP6UD)

• DOT Name: Colorectal cancer-associated protein 1 (COLCA1)
• Gene Name: COLCA1
• Related Disease:
  Colon cancer
  Colon carcinoma
  Colorectal adenocarcinoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Nasopharyngeal carcinoma
  Neoplasm
• UniProt ID: COLC1_HUMAN
• Sequence:
  MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQ
  GVCKDSKDLFVPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWF
  VAQH
• Tissue Specificity: Expressed in gastrointestinal and immune tissue, as well as prostate, testis and ovary. Expressed in lamina propria and eosinophils but not in epithelial cells. Expression is greater in benign adjacent tissues than in colon tumors.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Strong	Genetic Variation	[1]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[2]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[1]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[1]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[1]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Genetic Variation	[3]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[4]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Colorectal cancer-associated protein 1 (COLCA1).	[5]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Colorectal cancer-associated protein 1 (COLCA1).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Colorectal cancer-associated protein 1 (COLCA1).	[9]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Colorectal cancer-associated protein 1 (COLCA1).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Colorectal cancer-associated protein 1 (COLCA1).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Colorectal cancer-associated protein 1 (COLCA1).	[10]

References

• [1] Novel Common Genetic Susceptibility Loci for Colorectal Cancer.J Natl Cancer Inst. 2019 Feb 1;111(2):146-157. doi: 10.1093/jnci/djy099.
• [2] Identification of genes expressed by immune cells of the colon that are regulated by colorectal cancer-associated variants.Int J Cancer. 2014 May 15;134(10):2330-41. doi: 10.1002/ijc.28557. Epub 2013 Nov 13.
• [3] A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
• [4] In silico pathway analysis and tissue specific cis-eQTL for colorectal cancer GWAS risk variants.BMC Genomics. 2017 May 15;18(1):381. doi: 10.1186/s12864-017-3750-2.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.