Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8DQQRD)

• DOT Name: B-cell CLL/lymphoma 7 protein family member B (BCL7B)
• Synonyms: allergen Hom s 3
• Gene Name: BCL7B
• Related Disease:
  Lung adenocarcinoma
  Lung neoplasm
  Advanced cancer
  Gout
  Neoplasm
• UniProt ID: BCL7B_HUMAN
• Pfam ID: PF04714
• Sequence:
  MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKS
  KSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSES
  LSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDS
  GAPPLKRFCVDQPTVPQTASES
• Function: Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1. Involved in cell cycle progression, maintenance of the nuclear structure and stem cell differentiation. May play a role in lung tumor development or progression.
• Tissue Specificity: Ubiquitous.
• KEGG Pathway: ATP-dependent chromatin remodeling (hsa03082)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Lung neoplasm	DISVARNB	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Gout	DISHC0U7	Strong	Genetic Variation	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[6]
Selenium	DM25CGV	Approved	Selenium increases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[8]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[9]
Menthol	DMG2KW7	Approved	Menthol increases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[10]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[12]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[7]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[13]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of B-cell CLL/lymphoma 7 protein family member B (BCL7B).	[13]

References

• [1] Molecular profiling of mouse lung tumors: association with tumor progression, lung development, and human lung adenocarcinomas.Oncogene. 2004 Feb 5;23(5):1166-76. doi: 10.1038/sj.onc.1207234.
• [2] The Tumor Suppressor BCL7B Functions in the Wnt Signaling Pathway.PLoS Genet. 2015 Jan 8;11(1):e1004921. doi: 10.1371/journal.pgen.1004921. eCollection 2015 Jan.
• [3] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [10] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [11] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [13] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.