Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAUG6Y9)

• DOT Name: Calcium-regulated heat-stable protein 1 (CARHSP1)
• Synonyms: Calcium-regulated heat-stable protein of 24 kDa; CRHSP-24
• Gene Name: CARHSP1
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
• UniProt ID: CHSP1_HUMAN
• PDB ID: 3AQQ
• Pfam ID: PF00313
• Sequence:
  MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQG
  PVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEK
  LQAVEVVITHLAPGTKHETWSGHVISS
• Function: Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[1]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[1]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calcium-regulated heat-stable protein 1 (CARHSP1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Calcium-regulated heat-stable protein 1 (CARHSP1).	[16]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Calcium-regulated heat-stable protein 1 (CARHSP1).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Calcium-regulated heat-stable protein 1 (CARHSP1).	[20]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Calcium-regulated heat-stable protein 1 (CARHSP1).	[18]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[12]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[13]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[14]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[15]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[17]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[19]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[21]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[22]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[23]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[24]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Calcium-regulated heat-stable protein 1 (CARHSP1).	[25]

References

• [1] miR-155 acts as an anti-inflammatory factor in atherosclerosis-associated foam cell formation by repressing calcium-regulated heat stable protein 1.Sci Rep. 2016 Feb 22;6:21789. doi: 10.1038/srep21789.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [11] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [12] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [13] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [14] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [15] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [16] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [17] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [18] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [19] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [20] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [21] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [22] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [23] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [24] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [25] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.