Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAUWRK7)

DOT Name RNA-binding protein MEX3D (MEX3D)
Synonyms RING finger and KH domain-containing protein 1; RING finger protein 193; TINO
Gene Name MEX3D
Related Disease
Neurofibromatosis type 1 ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
MEX3D_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DGR
Pfam ID
PF00013 ; PF13920
Sequence
MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALR
LALDQLSALGLGGAGDTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVA
PGSLPLLDPNASPPPPPPPRPSPPDVFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMT
ECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREI
LSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQ
QRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGPDSDFHANGTD
VCLDLLGAAASLWAKTPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGP
ASPYSGSGNGGFAFGAEGPGAPVGTAAPDDCDFGFDFDFLALDLTVPAAATIWAPFERAA
PLPAFSGCSTVNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPVGA
LSWRPPQGPVSFPGGAAFSTATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALAREC
VVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIHIFS
Function RNA binding protein, may be involved in post-transcriptional regulatory mechanisms.
Tissue Specificity Ubiquitously expressed in all the cell lines and tissues tested.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neurofibromatosis type 1 DIS53JH9 moderate Altered Expression [1]
Prostate cancer DISF190Y Limited Genetic Variation [2]
Prostate carcinoma DISMJPLE Limited Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of RNA-binding protein MEX3D (MEX3D). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of RNA-binding protein MEX3D (MEX3D). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of RNA-binding protein MEX3D (MEX3D). [14]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of RNA-binding protein MEX3D (MEX3D). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of RNA-binding protein MEX3D (MEX3D). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of RNA-binding protein MEX3D (MEX3D). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of RNA-binding protein MEX3D (MEX3D). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of RNA-binding protein MEX3D (MEX3D). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of RNA-binding protein MEX3D (MEX3D). [9]
Menadione DMSJDTY Approved Menadione affects the expression of RNA-binding protein MEX3D (MEX3D). [10]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of RNA-binding protein MEX3D (MEX3D). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of RNA-binding protein MEX3D (MEX3D). [13]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of RNA-binding protein MEX3D (MEX3D). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of RNA-binding protein MEX3D (MEX3D). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Dysregulated gene expressions of MEX3D, FOS and BCL2 in human induced-neuronal (iN) cells from NF1 patients: a pilot study.Sci Rep. 2017 Oct 24;7(1):13905. doi: 10.1038/s41598-017-14440-7.
2 A novel approach to identify driver genes involved in androgen-independent prostate cancer.Mol Cancer. 2014 May 23;13:120. doi: 10.1186/1476-4598-13-120.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
10 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
11 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
16 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.