Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB7Q65H)

• DOT Name: Olfactory receptor 51E1 (OR51E1)
• Synonyms: D-GPCR; G-protein coupled receptor 164; Olfactory receptor 52A3; Prostate-overexpressed G protein-coupled receptor; Prostate-specific G protein-coupled receptor 2
• Gene Name: OR51E1
• Related Disease:
  Benign prostatic hyperplasia
  Carcinoid tumor
  Drug dependence
  Metastatic malignant neoplasm
  Neoplasm
  Neuroendocrine cancer
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Substance abuse
  Substance dependence
• UniProt ID: O51E1_HUMAN
• Pfam ID: PF13853
• Sequence:
  MMVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHE
  PMYIFLCMLSGIDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLA
  MAFDRYVAICHPLRHATVLTLPRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHS
  YCLHQDVMKLACDDIRVNVVYGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAF
  GTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKE
  IRQRILRLFHVATHASEP
• Function: Odorant receptor.
• Tissue Specificity: Highly expressed in prostate. Very low levels may be detected in some other tissues, such as placenta, skeletal muscle, heart, ovary and testis. Up-regulated in prostate cancers.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway:
  Expression and translocation of olfactory receptors (R-HSA-9752946)
  Olfactory Signaling Pathway (R-HSA-381753)

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[1]
Carcinoid tumor	DISMNRDC	Strong	Biomarker	[2]
Drug dependence	DIS9IXRC	Strong	Biomarker	[3]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Neuroendocrine cancer	DISVGJET	Strong	Biomarker	[4]
Prostate cancer	DISF190Y	Strong	Biomarker	[5]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[5]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[1]
Substance abuse	DIS327VW	Strong	Biomarker	[3]
Substance dependence	DISDRAAR	Strong	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Olfactory receptor 51E1 (OR51E1).	[6]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Olfactory receptor 51E1 (OR51E1).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Olfactory receptor 51E1 (OR51E1).	[8]

References

• [1] PSGR2, a novel G-protein coupled receptor, is overexpressed in human prostate cancer.Int J Cancer. 2006 Mar 15;118(6):1471-80. doi: 10.1002/ijc.21527.
• [2] Olfactory receptor 51E1 as a novel target for diagnosis in somatostatin receptor-negative lung carcinoids.J Mol Endocrinol. 2013 Nov 7;51(3):277-86. doi: 10.1530/JME-13-0144. Print 2013 Dec.
• [3] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [4] Olfactory receptor 51E1 protein as a potential novel tissue biomarker for small intestine neuroendocrine carcinomas.Eur J Endocrinol. 2013 Jan 17;168(2):253-61. doi: 10.1530/EJE-12-0814. Print 2013 Feb.
• [5] The activation of OR51E1 causes growth suppression of human prostate cancer cells.Oncotarget. 2016 Jul 26;7(30):48231-48249. doi: 10.18632/oncotarget.10197.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [8] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.