Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBVC3AO)

• DOT Name: Uncharacterized protein C14orf132 (C14ORF132)
• Gene Name: C14ORF132
• UniProt ID: CN132_HUMAN
• Sequence:
  MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAANGQGQPEDPPRSSNDAVL
  LWIAIIATLGNIVVVGVVYAFTF

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Uncharacterized protein C14orf132 (C14ORF132).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C14orf132 (C14ORF132).	[10]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Uncharacterized protein C14orf132 (C14ORF132).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[6]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[7]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[8]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[9]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Uncharacterized protein C14orf132 (C14ORF132).	[12]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [9] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Genome-wide gene expression profiling of low-dose, long-term exposure of human osteosarcoma cells to bisphenol A and its analogs bisphenols AF and S. Toxicol In Vitro. 2015 Aug;29(5):1060-9.
• [12] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.