Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCL5EE8)

DOT Name	Uncharacterized protein C17orf67 (C17ORF67)
Gene Name	C17ORF67
Related Disease	Androgen insensitivity syndrome ( ) Atypical hemolytic uremic syndrome ( ) Inflammatory bowel disease ( ) Ankylosing spondylitis ( ) Crohn disease ( ) Psoriasis ( ) Sclerosing cholangitis ( ) Ulcerative colitis ( )
UniProt ID	CQ067_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15076
Sequence	MKTLPVLVLSLTLLTVFSETSPILTEKQAKQLLRSRRQDRPSKPGFPDEPMREYMHHLLA LEHRAEEQFLEHWLNPHCKPHCDRNRIHPV

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Androgen insensitivity syndrome	DISUZBBO	Strong	Genetic Variation	[1]
Atypical hemolytic uremic syndrome	DIS6FUDJ	Strong	CausalMutation	[2]
Inflammatory bowel disease	DISGN23E	moderate	Genetic Variation	[3]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[4]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[4]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[4]
Sclerosing cholangitis	DIS7GZNB	Limited	Genetic Variation	[4]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein C17orf67 (C17ORF67).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Uncharacterized protein C17orf67 (C17ORF67).	[7]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Uncharacterized protein C17orf67 (C17ORF67).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Uncharacterized protein C17orf67 (C17ORF67).	[10]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Uncharacterized protein C17orf67 (C17ORF67).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C17orf67 (C17ORF67).	[9]
------------------------------------------------------------------------------------

References

1	Association between genetic determinants of peak height velocity during puberty and predisposition to adolescent idiopathic scoliosis.Spine (Phila Pa 1976). 2013 May 20;38(12):1034-9. doi: 10.1097/BRS.0b013e318287fcfd.
2	Phenotypic expansion of DGKE-associated diseases.J Am Soc Nephrol. 2014 Jul;25(7):1408-14. doi: 10.1681/ASN.2013080886. Epub 2014 Feb 7.
3	Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations.Nat Genet. 2015 Sep;47(9):979-986. doi: 10.1038/ng.3359. Epub 2015 Jul 20.
4	Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
5	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
8	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
9	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.