Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDNJFR4)

DOT Name Olfactomedin-like protein 2B (OLFML2B)
Synonyms Photomedin-2
Gene Name OLFML2B
Related Disease
Hepatocellular carcinoma ( )
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
OLM2B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02191
Sequence
MAKPRLLVLYFALIVVPAWVSSIVLTGTSEPPDAQTVAPAEDETLQNEADNQENVLSQLL
GDYDKVKAMSEGSDCQCKCVVRPLGRDACQRINAGASRKEDFYTVETITSGSSCKCACVA
PPSALNPCEGDFRLQKLREADSQDLKLSTIIDMLEGAFYGLDLLKLHSVTTKLVGRVDKL
EEEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQRDAAAAYAHP
EYEERFLQEETVSQQINSIELLQTRPLALPEVVKSQRPLQRQVHLRGRPASQPTVIRGIT
YYKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAV
TSDLNARTAPWSSALPQPSTSDPSIANHASVGPTLQTTSVSPDPTRESVLQPSPQVPATT
VAHTATQQPAAPAPPAVSPREALMEAMHTVPVPPTTVRTDSLGKDAPAGWGTTPASPTLS
PEEEDDIRNVIGRCKDTLSTITGPTTQNTYGRNEGAWMKDPLAKDERIYVTNYYYGNTLV
EFRNLENFKQGRWSNSYKLPYSWIGTGHVVYNGAFYYNRAFTRNIIKYDLKQRYVAAWAM
LHDVAYEEATPWRWQGHSDVDFAVDENGLWLIYPALDDEGFSQEVIVLSKLNAADLSTQK
ETTWRTGLRRNFYGNCFVICGVLYAVDSYNQRNANISYAFDTHTNTQIVPRLLFENEYSY
TTQIDYNPKDRLLYAWDNGHQVTYHVIFAY

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Definitive Biomarker [1]
Gastric cancer DISXGOUK Limited Biomarker [2]
Stomach cancer DISKIJSX Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Olfactomedin-like protein 2B (OLFML2B). [3]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Olfactomedin-like protein 2B (OLFML2B). [4]
Triclosan DMZUR4N Approved Triclosan increases the expression of Olfactomedin-like protein 2B (OLFML2B). [5]
Progesterone DMUY35B Approved Progesterone increases the expression of Olfactomedin-like protein 2B (OLFML2B). [6]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Olfactomedin-like protein 2B (OLFML2B). [7]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Olfactomedin-like protein 2B (OLFML2B). [7]
Piroxicam DMTK234 Approved Piroxicam increases the expression of Olfactomedin-like protein 2B (OLFML2B). [7]
Prednisolone DMQ8FR2 Approved Prednisolone increases the expression of Olfactomedin-like protein 2B (OLFML2B). [7]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Olfactomedin-like protein 2B (OLFML2B). [10]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Olfactomedin-like protein 2B (OLFML2B). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Olfactomedin-like protein 2B (OLFML2B). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Olfactomedin-like protein 2B (OLFML2B). [9]
------------------------------------------------------------------------------------

References

1 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
2 Bioinformatic exploration of OLFML2B overexpression in gastric cancer base on multiple analyzing tools.BMC Cancer. 2019 Mar 13;19(1):227. doi: 10.1186/s12885-019-5406-x.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
5 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
6 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
7 Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
11 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.