Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDR1HG6)

DOT Name Intraflagellar transport protein 25 homolog (IFT25)
Synonyms Heat shock protein beta-11; Hspb11; Placental protein 25; PP25
Gene Name IFT25
UniProt ID
IFT25_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1TVG; 1XPW
Pfam ID
PF00754
Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIE
RLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIV
SAFDHFASVHSVSAEGTVVSNLSS
Function
Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation.
Tissue Specificity Detected in placenta.
Reactome Pathway
Intraflagellar transport (R-HSA-5620924 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Intraflagellar transport protein 25 homolog (IFT25). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [3]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Intraflagellar transport protein 25 homolog (IFT25). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Intraflagellar transport protein 25 homolog (IFT25). [7]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [8]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Intraflagellar transport protein 25 homolog (IFT25). [9]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [10]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [11]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Intraflagellar transport protein 25 homolog (IFT25). [13]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Intraflagellar transport protein 25 homolog (IFT25). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Intraflagellar transport protein 25 homolog (IFT25). [11]
Arachidonic acid DMUOQZD Investigative Arachidonic acid decreases the expression of Intraflagellar transport protein 25 homolog (IFT25). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
5 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
9 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
10 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
11 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Label-free quantitative proteomic analysis identifies the oncogenic role of FOXA1 in BaP-transformed 16HBE cells. Toxicol Appl Pharmacol. 2020 Sep 15;403:115160. doi: 10.1016/j.taap.2020.115160. Epub 2020 Jul 25.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
16 Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.