Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDZYIIY)

• DOT Name: Protein FAM227B (FAM227B)
• Gene Name: FAM227B
• Related Disease:
  Chronic obstructive pulmonary disease
  Hyperthyroidism
  Lung adenocarcinoma
• UniProt ID: F227B_HUMAN
• Pfam ID: PF14922
• Sequence:
  MAGQRTCQRRSSRAGPGKMQEPPKSIEEFLKFQNWDYWPREIHFRDDDKWSCTLKKIKED
  SSFVSIYTHLWENVPRIFEALLIMESKLKEYSLILQNHTSEIFKWKSMISETSSYRKLER
  YGEFLKKYHKKKKIMLSDEMETEKNIEGCSFTGFKANELTQLPRHLDAEQIYLFILKAHN
  FDERVFKIWKTHFLSEASIALLHDSFWWWFLHKFRPDRENQDCLFDRISESYVTLFMSIP
  LSRKDAFFQIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFW
  IHWKLKELSTTTIHGSKKAPAKSVKERIADSQEHISTSIDFNIIKILNNPRAYTLPISKE
  ESRLSRLATKSHYSSTGPEFNRVLFNFGGQSPLILYYLKMHELAGISKAPKKTKIKLTKI
  FQEPLPAPTYRDVIKEAKRQFARNQKDFRILQAKATKKPHEVKQDFEKFLHKLRSEAEIE
  RECVASLSSSSSSSPSSTDNYNFEEEEY

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[1]
Hyperthyroidism	DISX87ZH	Strong	Genetic Variation	[2]
Lung adenocarcinoma	DISD51WR	Limited	Genetic Variation	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein FAM227B (FAM227B).	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein FAM227B (FAM227B).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein FAM227B (FAM227B).	[6]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Protein FAM227B (FAM227B).	[7]

References

• [1] Identification of FGF7 as a novel susceptibility locus for chronic obstructive pulmonary disease.Thorax. 2011 Dec;66(12):1085-90. doi: 10.1136/thoraxjnl-2011-200017. Epub 2011 Sep 15.
• [2] Genome-wide analyses identify a role for SLC17A4 and AADAT in thyroid hormone regulation.Nat Commun. 2018 Oct 26;9(1):4455. doi: 10.1038/s41467-018-06356-1.
• [3] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.