Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEN1HET)

• DOT Name: Nucleoporin-62 C-terminal-like protein (NUP62CL)
• Gene Name: NUP62CL
• UniProt ID: N62CL_HUMAN
• Pfam ID: PF05064
• Sequence:
  MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPY
  TSTVSVVATPVMTYGHLEGLINEWNLELEDQEKYFLLQATQVNAWDHTLIENGEMIRILH
  GEVNKVKLDQKRLEQELDFILSQQQELEFLLTYLEESTRDQSGLHYLQDADEEHVEISTR
  SAEF

Molecular Interaction Atlas (MIA) of This DOT

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[9]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[12]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[13]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[15]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[16]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[17]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Nucleoporin-62 C-terminal-like protein (NUP62CL).	[7]

References

• [1] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [11] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [14] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [17] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.