Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF6UDDB)

DOT Name ADP-ribosylation factor-like protein 11 (ARL11)
Synonyms ADP-ribosylation factor-like tumor suppressor protein 1
Gene Name ARL11
Related Disease
Benign prostatic hyperplasia ( )
Breast cancer ( )
Breast carcinoma ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Epithelial ovarian cancer ( )
Familial prostate carcinoma ( )
Hereditary breast carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Melanoma ( )
Neoplasm ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Advanced cancer ( )
Carcinoma ( )
UniProt ID
ARL11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00025
Sequence
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLT
LWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVL
ANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMC
LQARAHGAERGDSKRS
Function May play a role in apoptosis. May act as a tumor suppressor.
Tissue Specificity Expressed in lung and leukocytes.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Benign prostatic hyperplasia DISI3CW2 Strong Altered Expression [1]
Breast cancer DIS7DPX1 Strong Genetic Variation [2]
Breast carcinoma DIS2UE88 Strong Genetic Variation [2]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [3]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [4]
Epithelial ovarian cancer DIS56MH2 Strong Genetic Variation [5]
Familial prostate carcinoma DISL9KNO Strong Altered Expression [1]
Hereditary breast carcinoma DISAEZT5 Strong Genetic Variation [2]
Lung cancer DISCM4YA Strong Altered Expression [6]
Lung carcinoma DISTR26C Strong Altered Expression [6]
Lung neoplasm DISVARNB Strong Altered Expression [6]
Melanoma DIS1RRCY Strong Genetic Variation [7]
Neoplasm DISZKGEW Strong Altered Expression [8]
Ovarian cancer DISZJHAP Strong Genetic Variation [5]
Ovarian neoplasm DISEAFTY Strong Genetic Variation [5]
Advanced cancer DISAT1Z9 moderate Genetic Variation [1]
Carcinoma DISH9F1N moderate Biomarker [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of ADP-ribosylation factor-like protein 11 (ARL11). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of ADP-ribosylation factor-like protein 11 (ARL11). [11]
------------------------------------------------------------------------------------

References

1 Contribution of ARLTS1 Cys148Arg (T442C) variant with prostate cancer risk and ARLTS1 function in prostate cancer cells.PLoS One. 2011;6(10):e26595. doi: 10.1371/journal.pone.0026595. Epub 2011 Oct 20.
2 ARLTS1, MDM2 and RAD51 gene variations are associated with familial breast cancer.Mol Biol Rep. 2011 Jan;38(1):343-8. doi: 10.1007/s11033-010-0113-3. Epub 2010 Apr 1.
3 ARLTS1 germline variants and the risk for breast, prostate, and colorectal cancer.Eur J Hum Genet. 2008 Aug;16(8):983-91. doi: 10.1038/ejhg.2008.43. Epub 2008 Mar 12.
4 Association of the ARLTS1 Cys148Arg variant with sporadic and familial colorectal cancer.Carcinogenesis. 2007 Aug;28(8):1687-91. doi: 10.1093/carcin/bgm098. Epub 2007 Apr 21.
5 Association of the ARLTS1 variants with familial ovarian cancer risk in China.Int J Gynecol Cancer. 2009 May;19(4):585-90. doi: 10.1111/IGC.0b013e3181a39d03.
6 ARLTS1 - a novel tumor suppressor gene.Cancer Lett. 2008 Jun 8;264(1):11-20. doi: 10.1016/j.canlet.2008.02.021. Epub 2008 Mar 28.
7 ARLTS1 variants and melanoma risk.Int J Cancer. 2006 Oct 1;119(7):1736-7. doi: 10.1002/ijc.22008.
8 MAPping the kinase landscape of macrophage activation.J Biol Chem. 2018 Jun 22;293(25):9910-9911. doi: 10.1074/jbc.H118.003380.
9 Tumor suppressor functions of ARLTS1 in lung cancers.Cancer Res. 2007 Aug 15;67(16):7738-45. doi: 10.1158/0008-5472.CAN-07-1481.
10 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.