Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF8BTR9)

• DOT Name: G antigen 7 (GAGE7)
• Synonyms: GAGE-7; AL4; Cancer/testis antigen 4.7; CT4.7; GAGE-12I; GAGE-7B; GAGE-8
• Gene Name: GAGE7
• Related Disease:
  Lung cancer
  Lung carcinoma
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Salivary gland carcinoma
  Gastric cancer
  Metastatic malignant neoplasm
  Stomach cancer
  Colorectal carcinoma
• UniProt ID: GAGE7_HUMAN
• Pfam ID: PF05831
• Sequence:
  MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
  DEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
• Tissue Specificity: Expressed in some prostate cancer tissues but not in normal prostate tissue.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[3]
Salivary gland carcinoma	DISLVGGG	moderate	Biomarker	[4]
Gastric cancer	DISXGOUK	Disputed	Biomarker	[5]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Biomarker	[5]
Stomach cancer	DISKIJSX	Disputed	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Limited	Posttranslational Modification	[6]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	G antigen 7 (GAGE7) affects the response to substance of Mitomycin.	[11]
Mitoxantrone	DMM39BF	Approved	G antigen 7 (GAGE7) affects the response to substance of Mitoxantrone.	[11]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of G antigen 7 (GAGE7).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of G antigen 7 (GAGE7).	[9]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of G antigen 7 (GAGE7).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of G antigen 7 (GAGE7).	[8]

References

• [1] Early detection of lung cancer by using an autoantibody panel in Chinese population.Oncoimmunology. 2017 Oct 16;7(2):e1384108. doi: 10.1080/2162402X.2017.1384108. eCollection 2018.
• [2] Significance of tumor-associated autoantibodies in the early diagnosis of lung cancer.Clin Respir J. 2018 Jun;12(6):2020-2028. doi: 10.1111/crj.12769. Epub 2018 Feb 15.
• [3] Isolation and characterization of PAGE-1 and GAGE-7. New genes expressed in the LNCaP prostate cancer progression model that share homology with melanoma-associated antigens.J Biol Chem. 1998 Jul 10;273(28):17618-25. doi: 10.1074/jbc.273.28.17618.
• [4] Expression of cancer/testis antigens in salivary gland carcinomas with reference to MAGE-A and NY-ESO-1 expression in adenoid cystic carcinoma.Histopathology. 2017 Aug;71(2):305-315. doi: 10.1111/his.13226. Epub 2017 Jun 2.
• [5] GAGE7B promotes tumor metastasis and growth via activating the p38/pMAPKAPK2/pHSP27 pathway in gastric cancer.J Exp Clin Cancer Res. 2019 Mar 11;38(1):124. doi: 10.1186/s13046-019-1125-z.
• [6] Identification of methylation-silenced genes in colorectal cancer cell lines: genomic screening using oligonucleotide arrays.Scand J Gastroenterol. 2007 Dec;42(12):1486-94. doi: 10.1080/00365520701491173.
• [7] Treatment of chronic lymphocytic leukemia with a hypomethylating agent induces expression of NXF2, an immunogenic cancer testis antigen. Clin Cancer Res. 2009 May 15;15(10):3406-15. doi: 10.1158/1078-0432.CCR-08-2099. Epub 2009 Apr 28.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [10] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [11] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.