Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFNNLI1)

DOT Name Tetratricopeptide repeat protein 22 (TTC22)
Synonyms TPR repeat protein 22
Gene Name TTC22
Related Disease
Colon cancer ( )
Colorectal adenocarcinoma ( )
Colorectal adenoma ( )
Colorectal cancer ( )
Colorectal cancer, susceptibility to, 1 ( )
Colorectal cancer, susceptibility to, 10 ( )
Colorectal cancer, susceptibility to, 12 ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Colon carcinoma ( )
UniProt ID
TTC22_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13181
Sequence
MAELEAVADDLDALIDDLDYLPGHFHLEMQLNFEPRSPAPQRARDLKLQREGLRQELQLA
AAPQRPAVRHLLGAFAFYLEELDEARECFLEVAHEHPGNLNAWANLAHVYGRLGQEEEEE
ACAARLADLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALY
DKALGYGQQIPMEEKRGWYFTMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKS
EDPRHRALAWCYLGMLLERKDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR
LAKIFYFLGKQDMAIGTCNMALDVLRDPELNWQAYCTRAKIHIRAYLHDLKRAKMGLGGM
PDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLA
KAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTDGFGCLLEALL
AQWSQAQLSDGELGREVDAWLRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGR
PALVRLLFETMEREGEGASAPRDRRAVSF

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon cancer DISVC52G Strong Biomarker [1]
Colorectal adenocarcinoma DISPQOUB Strong Genetic Variation [2]
Colorectal adenoma DISTSVHM Strong Genetic Variation [2]
Colorectal cancer DISNH7P9 Strong Genetic Variation [2]
Colorectal cancer, susceptibility to, 1 DISZ794C Strong Genetic Variation [2]
Colorectal cancer, susceptibility to, 10 DISQXMYM Strong Genetic Variation [2]
Colorectal cancer, susceptibility to, 12 DIS4FXJX Strong Genetic Variation [2]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [2]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [2]
Colon carcinoma DISJYKUO moderate Biomarker [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Tetratricopeptide repeat protein 22 (TTC22). [3]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Tetratricopeptide repeat protein 22 (TTC22). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Tetratricopeptide repeat protein 22 (TTC22). [4]
------------------------------------------------------------------------------------

References

1 miR663aTTC22V1 axis inhibits colon cancer metastasis.Oncol Rep. 2019 Mar;41(3):1718-1728. doi: 10.3892/or.2019.6969. Epub 2019 Jan 16.
2 Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.