Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFPDYZU)

• DOT Name: Tumor protein p53-inducible protein 11 (TP53I11)
• Synonyms: p53-induced gene 11 protein
• Gene Name: TP53I11
• Related Disease:
  Hepatocellular carcinoma
  Gastric neoplasm
  Breast cancer
  Breast carcinoma
  Neoplasm
• UniProt ID: P5I11_HUMAN
• Pfam ID: PF14936
• Sequence:
  MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPL
  GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA
  LYTAEKVIIRWTLLTEACYFGVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYY
  QVGRRPKKA

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Disputed	Biomarker	[2]
Breast cancer	DIS7DPX1	Limited	Biomarker	[3]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[3]
Neoplasm	DISZKGEW	Limited	Biomarker	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cytarabine	DMZD5QR	Approved	Tumor protein p53-inducible protein 11 (TP53I11) increases the response to substance of Cytarabine.	[19]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[12]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[13]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[14]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[15]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[16]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[18]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[14]
Daidzein	DMRFTJX	Investigative	Daidzein decreases the expression of Tumor protein p53-inducible protein 11 (TP53I11).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Tumor protein p53-inducible protein 11 (TP53I11).	[17]

References

• [1] PIG11 over-expression predicts good prognosis and induces HepG2 cell apoptosis via reactive oxygen species-dependent mitochondrial pathway.Biomed Pharmacother. 2018 Dec;108:435-442. doi: 10.1016/j.biopha.2018.09.062. Epub 2018 Sep 18.
• [2] P53-induced gene 11 (PIG11) involved in arsenic trioxide-induced apoptosis in human gastric cancer MGC-803 cells.Oncol Rep. 2003 Sep-Oct;10(5):1265-9.
• [3] TP53I11 suppresses epithelial-mesenchymal transition and metastasis of breast cancer cells.BMB Rep. 2019 Jun;52(6):379-384. doi: 10.5483/BMBRep.2019.52.6.173.
• [4] Genome-wide cDNA microarray analysis of gene-expression profiles involved in ovarian endometriosis.Int J Oncol. 2003 Mar;22(3):551-60.
• [5] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [8] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [9] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [10] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [11] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [14] Possible roles of a tumor suppressor gene PIG11 in hepatocarcinogenesis and As2O3-induced apoptosis in liver cancer cells. J Gastroenterol. 2009;44(5):460-9. doi: 10.1007/s00535-009-0030-1. Epub 2009 Apr 1.
• [15] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [16] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [17] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [18] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [19] Genome-wide local ancestry approach identifies genes and variants associated with chemotherapeutic susceptibility in African Americans. PLoS One. 2011;6(7):e21920. doi: 10.1371/journal.pone.0021920. Epub 2011 Jul 6.