Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFVUGNQ)

• DOT Name: Alpha-1B-glycoprotein (A1BG)
• Synonyms: Alpha-1-B glycoprotein
• Gene Name: A1BG
• Related Disease:
  Adult glioblastoma
  Arthritis
  Epilepsy
  Exanthem
  Kidney angiomyolipoma
  Lymphangioleiomyomatosis
  Persistent truncus arteriosus
  Schizophrenia
  Meningioma
  Hepatocellular carcinoma
  Adenocarcinoma
  Amyotrophic lateral sclerosis
  Type-1/2 diabetes
• UniProt ID: A1BG_HUMAN
• Pfam ID: PF13895
• Sequence:
  MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL
  FKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
  LSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNY
  SCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVD
  FQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELI
  LSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFE
  LHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
  LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTF
  ESELSDPVELLVAES
• Tissue Specificity: Plasma.
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Arthritis	DIST1YEL	Strong	Biomarker	[2]
Epilepsy	DISBB28L	Strong	Genetic Variation	[3]
Exanthem	DISAFOQN	Strong	Biomarker	[4]
Kidney angiomyolipoma	DISRCMMM	Strong	Biomarker	[3]
Lymphangioleiomyomatosis	DISR0RNB	Strong	Genetic Variation	[3]
Persistent truncus arteriosus	DISRZ8EA	Strong	Biomarker	[5]
Schizophrenia	DISSRV2N	Strong	Biomarker	[6]
Meningioma	DISPT4TG	moderate	Altered Expression	[7]
Hepatocellular carcinoma	DIS0J828	Disputed	Altered Expression	[8]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[9]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[10]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[11]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Alpha-1B-glycoprotein (A1BG).	[12]
Olanzapine	DMPFN6Y	Approved	Olanzapine affects the phosphorylation of Alpha-1B-glycoprotein (A1BG).	[6]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-1B-glycoprotein (A1BG).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Alpha-1B-glycoprotein (A1BG).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Alpha-1B-glycoprotein (A1BG).	[15]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Alpha-1B-glycoprotein (A1BG).	[16]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Alpha-1B-glycoprotein (A1BG).	[17]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Alpha-1B-glycoprotein (A1BG).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Alpha-1B-glycoprotein (A1BG).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Alpha-1B-glycoprotein (A1BG).	[21]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Alpha-1B-glycoprotein (A1BG).	[22]

References

• [1] Transfection with GLS2 Glutaminase (GAB) Sensitizes Human Glioblastoma Cell Lines to Oxidative Stress by a Common Mechanism Involving Suppression of the PI3K/AKT Pathway.Cancers (Basel). 2019 Jan 19;11(1):115. doi: 10.3390/cancers11010115.
• [2] Mass spectrometry-based analysis of cerebrospinal fluid from arthritis patients-immune-related candidate proteins affected by TNF blocking treatment.Arthritis Res Ther. 2019 Feb 15;21(1):60. doi: 10.1186/s13075-019-1846-6.
• [3] Treatment Patterns and Use of Resources in Patients With Tuberous Sclerosis Complex: Insights From the TOSCA Registry.Front Neurol. 2019 Oct 25;10:1144. doi: 10.3389/fneur.2019.01144. eCollection 2019.
• [4] Outcomes of 44 Consecutive Complete Bilateral Cleft Lip and Palate Patients Treated With Secondary Alveolar Bone Grafting and Premaxillary Osteotomy.Cleft Palate Craniofac J. 2017 May;54(3):249-255. doi: 10.1597/15-162. Epub 2016 Mar 31.
• [5] Clinical and audiometric outcomes of palisade cartilage myringoplasty under local anesthetic in an office setting.Am J Otolaryngol. 2019 Jul-Aug;40(4):482-486. doi: 10.1016/j.amjoto.2019.03.015. Epub 2019 Mar 29.
• [6] Effects of olanzapine on serum protein phosphorylation patterns in patients with schizophrenia. Proteomics Clin Appl. 2015 Oct;9(9-10):907-16. doi: 10.1002/prca.201400148. Epub 2015 May 15.
• [7] Clinicopathological and molecular characteristics of pediatric meningiomas.Neuropathology. 2018 Feb;38(1):22-33. doi: 10.1111/neup.12426. Epub 2017 Sep 13.
• [8] Screening of biomarkers for liver adenoma in low-dose-rate -ray-irradiated mice.Int J Radiat Biol. 2018 Apr;94(4):315-326. doi: 10.1080/09553002.2018.1439193. Epub 2018 Mar 2.
• [9] Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients.BMC Cancer. 2008 Aug 16;8:241. doi: 10.1186/1471-2407-8-241.
• [10] GAB(A) receptors present higher affinity and modified subunit composition in spinal motor neurons from a genetic model of amyotrophic lateral sclerosis.Eur J Neurosci. 2008 Oct;28(7):1275-85. doi: 10.1111/j.1460-9568.2008.06436.x.
• [11] The role of organic cation transporter 2 inhibitor cimetidine, experimental diabetes mellitus and metformin on gabapentin pharmacokinetics in rats.Life Sci. 2018 May 1;200:63-68. doi: 10.1016/j.lfs.2018.03.012. Epub 2018 Mar 15.
• [12] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [13] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [14] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [17] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [18] Effects of olanzapine on serum protein phosphorylation patterns in patients with schizophrenia. Proteomics Clin Appl. 2015 Oct;9(9-10):907-16. doi: 10.1002/prca.201400148. Epub 2015 May 15.
• [19] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [22] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.