General Information of Drug Off-Target (DOT) (ID: OTFYWNFX)

DOT Name 14 kDa phosphohistidine phosphatase (PHPT1)
Synonyms EC 3.9.1.3; Phosphohistidine phosphatase 1; PHPT1; Protein histidine phosphatase; PHP; Protein janus-A homolog
Gene Name PHPT1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Congenital hypothyroidism ( )
Herpes simplex infection ( )
Hypoparathyroidism ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Ocular melanoma ( )
Pseudohypoparathyroidism ( )
Pseudohypoparathyroidism type 1A ( )
Pseudopseudohypoparathyroidism ( )
Turner syndrome ( )
Usher syndrome ( )
Beckwith-Wiedemann syndrome ( )
Neonatal diabetes mellitus ( )
Pseudohypoparathyroidism type 1B ( )
Brachydactyly ( )
Obesity ( )
UniProt ID
PHP14_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2AI6; 2HW4; 2NMM; 2OZW; 2OZX
EC Number
3.9.1.3
Pfam ID
PF05005
Sequence
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKV
SGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTW
ANDGY
Function Exhibits phosphohistidine phosphatase activity.
Tissue Specificity Expressed abundantly in heart and skeletal muscle.
BioCyc Pathway
MetaCyc:ENSG00000054148-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Congenital hypothyroidism DISL5XVU Strong Genetic Variation [2]
Herpes simplex infection DISL1SAV Strong Altered Expression [3]
Hypoparathyroidism DISICS0V Strong Biomarker [4]
Lung cancer DISCM4YA Strong Biomarker [5]
Lung carcinoma DISTR26C Strong Biomarker [5]
Neoplasm DISZKGEW Strong Biomarker [6]
Ocular melanoma DISOHHFC Strong Biomarker [6]
Pseudohypoparathyroidism DIS183OJ Strong Biomarker [7]
Pseudohypoparathyroidism type 1A DISSOR3M Strong Genetic Variation [8]
Pseudopseudohypoparathyroidism DISRRO5I Strong Genetic Variation [9]
Turner syndrome DIS2035C Strong Biomarker [10]
Usher syndrome DIS9YIS7 Strong Genetic Variation [11]
Beckwith-Wiedemann syndrome DISH15GR moderate Biomarker [12]
Neonatal diabetes mellitus DISFHF9K moderate Biomarker [12]
Pseudohypoparathyroidism type 1B DIS9LDXL Disputed Genetic Variation [13]
Brachydactyly DIS2533F Limited Biomarker [7]
Obesity DIS47Y1K Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of 14 kDa phosphohistidine phosphatase (PHPT1). [14]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of 14 kDa phosphohistidine phosphatase (PHPT1). [20]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [15]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [16]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [17]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [18]
Decitabine DMQL8XJ Approved Decitabine affects the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [17]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [21]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [22]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [23]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of 14 kDa phosphohistidine phosphatase (PHPT1). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 B-CAN: a resource sharing platform to improve the operation, visualization and integrated analysis of TCGA breast cancer data.Oncotarget. 2017 Oct 19;8(65):108778-108785. doi: 10.18632/oncotarget.21947. eCollection 2017 Dec 12.
2 A novel mutation causing pseudohypoparathyroidism 1A with congenital hypothyroidism and osteoma cutis.J Clin Res Pediatr Endocrinol. 2009;1(5):244-7. doi: 10.4274/jcrpe.v1i5.244. Epub 2009 Aug 6.
3 Tau-mediated cytotoxicity in a pseudohyperphosphorylation model of Alzheimer's disease.J Neurosci. 2002 Nov 15;22(22):9733-41. doi: 10.1523/JNEUROSCI.22-22-09733.2002.
4 Bone Mineral Density and Its Serial Changes Are Associated With PTH Levels in Pseudohypoparathyroidism Type 1B Patients.J Bone Miner Res. 2018 Apr;33(4):743-752. doi: 10.1002/jbmr.3360. Epub 2018 Jan 3.
5 Knockdown of 14-kDa phosphohistidine phosphatase expression suppresses lung cancer cell growth in vivo possibly through inhibition of NF-B signaling pathway.Neoplasma. 2016;63(4):540-7. doi: 10.4149/neo_2016_407.
6 Embolization of variant hepatic arteries in patients undergoing percutaneous hepatic perfusion for unresectable liver metastases from ocular melanoma.Diagn Interv Radiol. 2019 Nov;25(6):451-458. doi: 10.5152/dir.2019.18138.
7 Pseudohypoparathyroidism vs. tricho-rhino-phalangeal syndrome: patient reclassification.J Pediatr Endocrinol Metab. 2014 Nov;27(11-12):1089-94. doi: 10.1515/jpem-2014-0020.
8 Genetic and Epigenetic Defects at the GNAS Locus Lead to Distinct Patterns of Skeletal Growth but Similar Early-Onset Obesity.J Bone Miner Res. 2018 Aug;33(8):1480-1488. doi: 10.1002/jbmr.3450. Epub 2018 Jun 7.
9 Pseudohypoparathyroidism Ia and hypercalcitoninemia.J Clin Endocrinol Metab. 2001 Jul;86(7):3091-6. doi: 10.1210/jcem.86.7.7690.
10 Dermatoglyphic and radiographic findings in a mother and daughter with pseudohypoparathyroidism.Clin Genet. 1978 Apr;13(4):359-68. doi: 10.1111/j.1399-0004.1978.tb01193.x.
11 Gene Transfer with AAV9-PHP.B Rescues Hearing in a Mouse Model of Usher Syndrome 3A and Transduces Hair Cells in a Non-human Primate.Mol Ther Methods Clin Dev. 2018 Nov 20;13:1-13. doi: 10.1016/j.omtm.2018.11.003. eCollection 2019 Jun 14.
12 New mechanisms involved in paternal 20q disomy associated with pseudohypoparathyroidism.Eur J Endocrinol. 2010 Dec;163(6):953-62. doi: 10.1530/EJE-10-0435. Epub 2010 Sep 13.
13 Pseudohypoparathyroidism. New insights into an old disease.Endocrinol Metab Clin North Am. 2000 Sep;29(3):569-89. doi: 10.1016/s0889-8529(05)70151-1.
14 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
15 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
16 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
17 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
18 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
19 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
20 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
21 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
22 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
23 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
24 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.