Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG1EI22)

• DOT Name: LHFPL tetraspan subfamily member 3 protein (LHFPL3)
• Synonyms: Lipoma HMGIC fusion partner-like 3 protein
• Gene Name: LHFPL3
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Glioma
  Neoplasm
  Obesity
  Acute myelogenous leukaemia
  Bipolar disorder
  Gout
• UniProt ID: LHPL3_HUMAN
• Pfam ID: PF10242
• Sequence:
  MPGAAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYW
  IGDGVDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLII
  ACIICFTLFFFCNTATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYT
  LGACSVRWAYILAIIGILDALILSFLAFVLGNRQDSLMAEELKAENKVLLSQYSLE

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Obesity	DIS47Y1K	Strong	Genetic Variation	[3]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[4]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[5]
Gout	DISHC0U7	Limited	Genetic Variation	[6]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of LHFPL tetraspan subfamily member 3 protein (LHFPL3).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of LHFPL tetraspan subfamily member 3 protein (LHFPL3).	[8]
Octanal	DMTN0OK	Investigative	Octanal increases the methylation of LHFPL tetraspan subfamily member 3 protein (LHFPL3).	[9]

References

• [1] Identification of novel genetic alterations in samples of malignant glioma patients.PLoS One. 2013 Dec 16;8(12):e82108. doi: 10.1371/journal.pone.0082108. eCollection 2013.
• [2] MiR-218-5p targets LHFPL3 to regulate proliferation, migration, and epithelial-mesenchymal transitions of human glioma cells.Biosci Rep. 2019 Mar 1;39(3):BSR20180879. doi: 10.1042/BSR20180879. Print 2019 Mar 29.
• [3] A genome-wide association study on obesity and obesity-related traits.PLoS One. 2011 Apr 28;6(4):e18939. doi: 10.1371/journal.pone.0018939.
• [4] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [5] Genetic variants associated with response to lithium treatment in bipolar disorder: a genome-wide association study.Lancet. 2016 Mar 12;387(10023):1085-1093. doi: 10.1016/S0140-6736(16)00143-4. Epub 2016 Jan 22.
• [6] Gout and type 2 diabetes have a mutual inter-dependent effect on genetic risk factors and higher incidences.Rheumatology (Oxford). 2012 Apr;51(4):715-20. doi: 10.1093/rheumatology/ker373. Epub 2011 Dec 16.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] DNA Methylome Analysis of Saturated Aliphatic Aldehydes in Pulmonary Toxicity. Sci Rep. 2018 Jul 12;8(1):10497. doi: 10.1038/s41598-018-28813-z.