Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG6HB6U)

DOT Name Golgin subfamily A member 5 (GOLGA5)
Synonyms Cell proliferation-inducing gene 31 protein; Golgin-84; Protein Ret-II; RET-fused gene 5 protein
Gene Name GOLGA5
Related Disease
Thyroid gland carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid tumor ( )
Colorectal adenocarcinoma ( )
UniProt ID
GOGA5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09787
Sequence
MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKS
TYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDD
ELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQT
HEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQS
LNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQ
LAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADAT
LKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLN
LESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQRE
EIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQ
EFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQ
KQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGTRLRNVPVLFN
DTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYT
PEMHHDQPYGK
Function Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport.
Tissue Specificity Ubiquitous. Highly expressed in seminiferous tubules and Leydig cells in testis, and detected at much lower levels in the other tissues tested. Expression is very low or not detectable in spermatozoa.
Reactome Pathway
Intra-Golgi traffic (R-HSA-6811438 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thyroid gland carcinoma DISMNGZ0 Strong Genetic Variation [1]
Thyroid gland papillary carcinoma DIS48YMM Strong FusionGene [2]
Thyroid tumor DISLVKMD Strong Biomarker [1]
Colorectal adenocarcinoma DISPQOUB Limited Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Golgin subfamily A member 5 (GOLGA5). [4]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Golgin subfamily A member 5 (GOLGA5). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Golgin subfamily A member 5 (GOLGA5). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Golgin subfamily A member 5 (GOLGA5). [7]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Golgin subfamily A member 5 (GOLGA5). [7]
Afimoxifene DMFORDT Phase 2 Afimoxifene decreases the expression of Golgin subfamily A member 5 (GOLGA5). [7]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Golgin subfamily A member 5 (GOLGA5). [8]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Golgin subfamily A member 5 (GOLGA5). [9]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Golgin subfamily A member 5 (GOLGA5). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Detection of a novel type of RET rearrangement (PTC5) in thyroid carcinomas after Chernobyl and analysis of the involved RET-fused gene RFG5.Cancer Res. 1998 Jan 15;58(2):198-203.
2 RET/PTC activation in papillary thyroid carcinoma: European Journal of Endocrinology Prize Lecture.Eur J Endocrinol. 2006 Nov;155(5):645-53. doi: 10.1530/eje.1.02289.
3 Site-specific gene expression profiles and novel molecular prognostic factors in patients with lower gastrointestinal adenocarcinoma diffusely metastatic to liver or peritoneum.Ann Surg Oncol. 2007 Dec;14(12):3460-71. doi: 10.1245/s10434-007-9557-7. Epub 2007 Sep 25.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
8 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
9 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
10 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.