Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG94RJ4)

• DOT Name: Synaptotagmin-13 (SYT13)
• Synonyms: Synaptotagmin XIII; SytXIII
• Gene Name: SYT13
• Related Disease:
  Neoplasm
  Cocaine addiction
  Lung adenocarcinoma
  Gastric cancer
  Stomach cancer
• UniProt ID: SYT13_HUMAN
• PDB ID: 1WFM
• Pfam ID: PF00168
• Sequence:
  MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQ
  QFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDS
  RLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRL
  EAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLT
  LTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPA
  ANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMI
  MFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAM
  WHQLHL
• Function: May be involved in transport vesicle docking to the plasma membrane.
• Tissue Specificity: Expressed in brain, pancreas and kidney.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Cocaine addiction	DISHTRXG	Strong	Biomarker	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[3]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[4]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cocaine	DMSOX7I	Approved	Synaptotagmin-13 (SYT13) affects the response to substance of Cocaine.	[2]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Synaptotagmin-13 (SYT13).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Synaptotagmin-13 (SYT13).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Synaptotagmin-13 (SYT13).	[7]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Synaptotagmin-13 (SYT13).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Synaptotagmin-13 (SYT13).	[8]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Synaptotagmin-13 (SYT13).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Synaptotagmin-13 (SYT13).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Synaptotagmin-13 (SYT13).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Synaptotagmin-13 (SYT13).	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Synaptotagmin-13 (SYT13).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Synaptotagmin-13 (SYT13).	[13]

References

• [1] Exogenous expression of synaptotagmin XIII suppresses the neoplastic phenotype of a rat liver tumor cell line through molecular pathways related to mesenchymal to epithelial transition.Exp Mol Pathol. 2010 Dec;89(3):209-16. doi: 10.1016/j.yexmp.2010.09.001. Epub 2010 Sep 16.
• [2] Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.
• [3] Identification SYT13 as a novel biomarker in lung adenocarcinoma.J Cell Biochem. 2020 Feb;121(2):963-973. doi: 10.1002/jcb.29224. Epub 2019 Oct 17.
• [4] The levels of SYT13 and CEA mRNAs in peritoneal lavages predict the peritoneal recurrence of gastric cancer.Gastric Cancer. 2019 Nov;22(6):1143-1152. doi: 10.1007/s10120-019-00967-3. Epub 2019 May 4.
• [5] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [6] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [7] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [8] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [9] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [13] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [14] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [15] Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.